PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

augustus_masked-scaffold27471-abinit-gene-0.0-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

MYB_related

Protein Properties

Length: 99aa MW: 11629.7 Da PI: 10.569

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
augustus_masked-scaffold27471-abinit-gene-0.0-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.4	6e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+++Ed+ l+++++ +G g W++ +r+ g++R++k+c++rw +yl augustus_masked-scaffold27471-abinit-gene-0.0-mRNA-1 14 KGTWSAQEDQMLKNYIATHGQGKWRSLPRKAGLKRCGKSCRLRWMNYL 61 799*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.2E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	23.173	9	65	IPR017930	Myb domain
SMART	SM00717	1.8E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.0E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	7.85E-23	15	89	IPR009057	Homeodomain-like
CDD	cd00167	3.35E-10	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.7E-9	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MGRSPCCSKM EVKKGTWSAQ EDQMLKNYIA THGQGKWRSL PRKAGLKRCG KSCRLRWMNY 60 LNPDIKRGNI TPDEEDLIIR LHKLLGNRYF PLFFLIQFV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-15	11	96	24	108	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269\|PubMed:15923334, ECO:0000269\|PubMed:17419845, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:20731781}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269\|PubMed:17053893, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB434650	9e-44	AB434650.1 Fagus crenata FcMYB558 gene for transcription factor MYB558, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010047497.1	2e-48	PREDICTED: myb-related protein 330
Swissprot	O22264	9e-44	MYB12_ARATH; Transcription factor MYB12
TrEMBL	A0A059CLX4	4e-47	A0A059CLX4_EUCGR; Uncharacterized protein
STRING	XP_010047497.1	6e-48	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47460.1	4e-46	myb domain protein 12

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Pandey A, et al. Co-expression of Arabidopsis transcription factor, AtMYB12, and soybean isoflavone synthase, GmIFS1, genes in tobacco leads to enhanced biosynthesis of isoflavones and flavonols resulting in osteoprotective activity. Plant Biotechnol. J., 2014. 12(1): p. 69-80 [PMID:24102754] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Pandey A, et al. AtMYB12 expression in tomato leads to large scale differential modulation in transcriptome and flavonoid content in leaf and fruit tissues. Sci Rep, 2015. 5: p. 12412 [PMID:26206248] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li Y, et al. Development of Marker-Free Transgenic Potato Tubers Enriched in Caffeoylquinic Acids and Flavonols. J. Agric. Food Chem., 2016. 64(14): p. 2932-40 [PMID:27019017] Zhou Z,Schenke D,Miao Y,Cai D Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings. Plant Cell Environ., 2017. 40(3): p. 453-458 [PMID:28032363] Wang N, et al. MYB12 and MYB22 play essential roles in proanthocyanidin and flavonol synthesis in red-fleshed apple (Malus sieversii f. niedzwetzkyana). Plant J., 2017. 90(2): p. 276-292 [PMID:28107780] Stracke R,Turgut-Kara N,Weisshaar B The AtMYB12 activation domain maps to a short C-terminal region of the transcription factor. Z. Naturforsch., C, J. Biosci., 2017. 72(7-8): p. 251-257 [PMID:28284041] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Hidalgo D, et al. Tailoring tobacco hairy root metabolism for the production of stilbenes. Sci Rep, 2017. 7(1): p. 17976 [PMID:29269790]