PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_10077_iso_4

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

M-type_MADS

Protein Properties

Length: 70aa MW: 8175.17 Da PI: 10.3743

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_10077_iso_4	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.1	2e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g++yey++ cra_locus_10077_iso_4_len_330_ver_3 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYAN 59 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.4E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.978	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.88E-33	2	69	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.87E-42	2	69	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	6.3E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRVYEYANN 60 NIRSTIDRYX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	9e-23	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development. {ECO:0000269\|PubMed:29853599}.
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011095997.1	3e-43	agamous-like MADS-box protein AGL11
Refseq	XP_011096010.1	3e-43	agamous-like MADS-box protein AGL11
Refseq	XP_011096018.1	3e-43	agamous-like MADS-box protein AGL11
Refseq	XP_011096026.1	3e-43	agamous-like MADS-box protein AGL11
Swissprot	A0A217EJJ0	2e-42	AG11S_VITVI; Agamous-like MADS-box protein AGL11
Swissprot	F6I457	2e-42	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A022Q439	9e-42	A0A022Q439_ERYGU; Uncharacterized protein
STRING	Migut.C01334.1.p	2e-42	(Erythranthe guttata)

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]