PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_102390_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

WRKY

Protein Properties

Length: 109aa MW: 12766.2 Da PI: 10.2773

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_102390_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	96.5	1.7e-30	34	92	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s +pr+YY+C+ +gCpvkk+ver+++d ++v++tYeg Hnh+ cra_locus_102390_iso_1_len_326_ver_3 34 LDDGFKWRKYGRKMVKNSINPRNYYKCSVEGCPVKKRVERDNNDSRYVVTTYEGIHNHQ 92 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.3E-32	21	94	IPR003657	WRKY domain
SuperFamily	SSF118290	8.11E-28	27	94	IPR003657	WRKY domain
PROSITE profile	PS50811	30.171	29	94	IPR003657	WRKY domain
SMART	SM00774	2.1E-33	34	93	IPR003657	WRKY domain
Pfam	PF03106	1.4E-23	35	92	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
RERSTANREN GSGREKKEIR EKVAFKTKSD VEILDDGFKW RKYGRKMVKN SINPRNYYKC 60 SVEGCPVKKR VERDNNDSRY VVTTYEGIHN HQGPMHXCQS SMIHKLPSS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	9e-25	24	95	7	78	Probable WRKY transcription factor 4
2lex_A	9e-25	24	95	7	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011100937.1	1e-50	probable WRKY transcription factor 50
Swissprot	Q8VWQ5	2e-38	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A2G9HW23	5e-47	A0A2G9HW23_9LAMI; Uncharacterized protein
STRING	Migut.E01579.1.p	2e-48	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2124	24	62

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]