PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_105483_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB_related

Protein Properties

Length: 107aa MW: 11970.8 Da PI: 8.0472

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_105483_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	64.3	2.4e-20	48	91	4	48
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT+eEd l++avk++ g++Wk+Ia++m gRt+ qc +rwqk+l cra_locus_105483_iso_1_len_319_ver_3 48 WTEEEDNMLAEAVKKYNGRNWKKIAECMT-GRTDVQCLHRWQKVL 91 **************************9.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	20.67	40	95	IPR017930	Myb domain
SuperFamily	SSF46689	2.28E-21	43	106	IPR009057	Homeodomain-like
SMART	SM00717	2.1E-15	44	93	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-23	47	106	IPR009057	Homeodomain-like
CDD	cd00167	1.43E-14	48	91	No hit	No description
Pfam	PF00249	6.9E-18	48	91	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	4.553	92	107	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
XDLMKEVGFV SNASPSDSSS DAINKKSPSG SGVRRNSCAT KRSSQAGWTE EEDNMLAEAV 60 KKYNGRNWKK IAECMTGRTD VQCLHRWQKV LNPELVKGPW TKEEDDX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h88_C	3e-19	48	105	9	66	MYB PROTO-ONCOGENE PROTEIN
1h89_C	3e-19	48	105	9	66	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269\|PubMed:17293435, ECO:0000269\|PubMed:19279197}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269\|PubMed:17293435}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028118929.1	2e-45	transcription factor MYB3R-4-like isoform X2
Swissprot	Q0JHU7	9e-31	MB3R2_ORYSJ; Transcription factor MYB3R-2
TrEMBL	A0A068UNB7	2e-40	A0A068UNB7_COFCA; Uncharacterized protein
STRING	XP_009606734.1	1e-38	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA19350	3	3

Publications ? help Back to Top
Kakar KU, et al. A consortium of rhizobacterial strains and biochemical growth elicitors improve cold and drought stress tolerance in rice (Oryza sativa L.). Plant Biol (Stuttg), 2016. 18(3): p. 471-83 [PMID:26681628]