![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_11055_iso_3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 185aa MW: 19687.3 Da PI: 8.3568 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 82.6 | 9.9e-26 | 88 | 134 | 2 | 48 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdskti 48
++k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti
cra_locus_11055_iso_3_len_1082_ver_3 88 PPKRTSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETI 134
789*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 2.2E-20 | 92 | 134 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 16.618 | 94 | 148 | IPR017887 | Transcription factor TCP subgroup |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008283 | Biological Process | cell proliferation | ||||
| GO:0009735 | Biological Process | response to cytokinin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0010029 | Biological Process | regulation of seed germination | ||||
| GO:0010229 | Biological Process | inflorescence development | ||||
| GO:0031347 | Biological Process | regulation of defense response | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 185 aa Download sequence Send to blast |
MEGAGDDHHL HHHHHHHHRQ NFPFQLLEKK EDIESASCSS GGASASGFPS LAISSADNNN 60 QNQNPQRSTS SSLQITAAAA AEPSKKPPPK RTSTKDRHTK VDGRGRRIRM PALCAARVFQ 120 LTRELGHKSD GETINGGGNG LGDAQLGMLT GLNPYRSGGV AESPASGSHS HHGGDDRHDS 180 TSHHS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved the regulation of plant development. Together with TCP14, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in developing leaf blade and specific floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Involved in gynoecium and silique development. Modulates the development of the different tissues of the gynoecium through its participation in auxin and cytokinin responses. Modulates the expression of the cytokinin-responsive genes ARR7 and ARR15. May repress the expression of the auxin biosynthetic genes YUC1 and YUC4 (PubMed:26303297). Acts as negative regulator of anthocyanin accumulation under high light conditions. Modulates the expression of transcription factors involved in the induction of anthocyanin biosynthesis genes (PubMed:26574599). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). {ECO:0000269|PubMed:21668538, ECO:0000269|PubMed:22267487, ECO:0000269|PubMed:24689742, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:25757472, ECO:0000269|PubMed:26303297, ECO:0000269|PubMed:26574599}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00396 | DAP | Transfer from AT3G47620 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:21183706). Induced during seed imbibition (PubMed:25655823). Induced by cytokinin (PubMed:26303297). {ECO:0000269|PubMed:21183706, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:26303297}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004299376.1 | 2e-49 | PREDICTED: transcription factor TCP14 | ||||
| Swissprot | Q9C9L2 | 4e-29 | TCP15_ARATH; Transcription factor TCP15 | ||||
| TrEMBL | A0A068UVP6 | 4e-47 | A0A068UVP6_COFCA; Uncharacterized protein | ||||
| TrEMBL | A0A4P1R2V5 | 3e-47 | A0A4P1R2V5_LUPAN; Uncharacterized protein | ||||
| STRING | XP_004299376.1 | 8e-49 | (Fragaria vesca) | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




