PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_11055_iso_3

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

TCP

Protein Properties

Length: 185aa MW: 19687.3 Da PI: 8.3568

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_11055_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	82.6	9.9e-26	88	134	2	48
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdskti 48 ++k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti cra_locus_11055_iso_3_len_1082_ver_3 88 PPKRTSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETI 134 789*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	2.2E-20	92	134	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	16.618	94	148	IPR017887	Transcription factor TCP subgroup

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0008283	Biological Process	cell proliferation
GO:0009735	Biological Process	response to cytokinin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0010029	Biological Process	regulation of seed germination
GO:0010229	Biological Process	inflorescence development
GO:0031347	Biological Process	regulation of defense response
GO:0005634	Cellular Component	nucleus

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MEGAGDDHHL HHHHHHHHRQ NFPFQLLEKK EDIESASCSS GGASASGFPS LAISSADNNN 60 QNQNPQRSTS SSLQITAAAA AEPSKKPPPK RTSTKDRHTK VDGRGRRIRM PALCAARVFQ 120 LTRELGHKSD GETINGGGNG LGDAQLGMLT GLNPYRSGGV AESPASGSHS HHGGDDRHDS 180 TSHHS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved the regulation of plant development. Together with TCP14, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in developing leaf blade and specific floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Involved in gynoecium and silique development. Modulates the development of the different tissues of the gynoecium through its participation in auxin and cytokinin responses. Modulates the expression of the cytokinin-responsive genes ARR7 and ARR15. May repress the expression of the auxin biosynthetic genes YUC1 and YUC4 (PubMed:26303297). Acts as negative regulator of anthocyanin accumulation under high light conditions. Modulates the expression of transcription factors involved in the induction of anthocyanin biosynthesis genes (PubMed:26574599). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). {ECO:0000269\|PubMed:21668538, ECO:0000269\|PubMed:22267487, ECO:0000269\|PubMed:24689742, ECO:0000269\|PubMed:25655823, ECO:0000269\|PubMed:25757472, ECO:0000269\|PubMed:26303297, ECO:0000269\|PubMed:26574599}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00396	DAP	Transfer from AT3G47620	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:21183706). Induced during seed imbibition (PubMed:25655823). Induced by cytokinin (PubMed:26303297). {ECO:0000269\|PubMed:21183706, ECO:0000269\|PubMed:25655823, ECO:0000269\|PubMed:26303297}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004299376.1	2e-49	PREDICTED: transcription factor TCP14
Swissprot	Q9C9L2	4e-29	TCP15_ARATH; Transcription factor TCP15
TrEMBL	A0A068UVP6	4e-47	A0A068UVP6_COFCA; Uncharacterized protein
TrEMBL	A0A4P1R2V5	3e-47	A0A4P1R2V5_LUPAN; Uncharacterized protein
STRING	XP_004299376.1	8e-49	(Fragaria vesca)

Publications ? help Back to Top
Steiner E, et al. The Putative O-Linked N-Acetylglucosamine Transferase SPINDLY Inhibits Class I TCP Proteolysis to Promote Sensitivity to Cytokinin. Plant Physiol., 2016. 171(2): p. 1485-94 [PMID:27208284] Dong H, et al. Ubiquitylation activates a peptidase that promotes cleavage and destabilization of its activating E3 ligases and diverse growth regulatory proteins to limit cell proliferation in Arabidopsis. Genes Dev., 2017. 31(2): p. 197-208 [PMID:28167503] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Mazur MJ, et al. Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci. Front Plant Sci, 2017. 8: p. 2043 [PMID:29250092]