PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_11487_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

HSF

Protein Properties

Length: 130aa MW: 13982.3 Da PI: 4.3928

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_11487_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	87.7	1.5e-27	43	102	2	61
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl k+y++++d+++++++sws+++nsfvv+d+ efa+++LpkyFkh+nf+SFvRQLn+Yg cra_locus_11487_iso_1_len_495_ver_3 43 FLVKTYDMVDDPSTDKIVSWSSTNNSFVVWDPPEFARDLLPKYFKHNNFSSFVRQLNTYG 102 9**********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	6.1E-30	35	102	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	3.63E-26	39	105	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	4.7E-30	39	130	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	3.0E-23	43	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.3E-17	43	66	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.3E-17	81	93	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.3E-17	94	106	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009408	Biological Process	response to heat
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MAASSNGRGK ALAADGGGEG NAGSPPPTPA PAPMPNTNAP PPFLVKTYDM VDDPSTDKIV 60 SWSSTNNSFV VWDPPEFARD LLPKYFKHNN FSSFVRQLNT YGEVESLNLV YILIDIEYVH 120 AGSFCDPXAA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	3e-21	41	102	27	88	Heat shock factor protein 1
5d5v_B	3e-21	41	102	27	88	Heat shock factor protein 1
5d5v_D	3e-21	41	102	27	88	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015160909.1	4e-48	PREDICTED: heat shock factor protein HSF8 isoform X1
Refseq	XP_015160911.1	4e-48	PREDICTED: heat shock factor protein HSF8 isoform X2
Swissprot	Q9LQM7	6e-41	HFA1D_ARATH; Heat stress transcription factor A-1d
TrEMBL	A0A061G5S9	3e-43	A0A061G5S9_THECC; Heat shock transcription factor A1D isoform 1
STRING	EOY25160	5e-44	(Theobroma cacao)

Publications ? help Back to Top
Higashi Y, et al. HsfA1d, a protein identified via FOX hunting using Thellungiella salsuginea cDNAs improves heat tolerance by regulating heat-stress-responsive gene expression. Mol Plant, 2013. 6(2): p. 411-22 [PMID:23393165] Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ohama N, et al. The Transcriptional Cascade in the Heat Stress Response of Arabidopsis Is Strictly Regulated at the Level of Transcription Factor Expression. Plant Cell, 2016. 28(1): p. 181-201 [PMID:26715648]