PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_12712_iso_2

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NAC

Protein Properties

Length: 100aa MW: 11842.8 Da PI: 7.817

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_12712_iso_2	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	61.7	2.3e-19	26	74	3	52
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52 pGfrFhPtdeelv +yL++kve++++++ e ik++diyk++Pw+Lp+k + cra_locus_12712_iso_2_len_297_ver_3 26 PGFRFHPTDEELVGFYLRRKVEKRPISI-ELIKQIDIYKHDPWNLPSKSY 74 9*************************.89*************5433 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	19.506	24	100	IPR003441	NAC domain
SuperFamily	SSF101941	3.4E-18	25	74	IPR003441	NAC domain
Pfam	PF02365	2.4E-9	26	97	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005992	Biological Process	trehalose biosynthetic process
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006561	Biological Process	proline biosynthetic process
GO:0009718	Biological Process	anthocyanin-containing compound biosynthetic process
GO:0010120	Biological Process	camalexin biosynthetic process
GO:0042538	Biological Process	hyperosmotic salinity response
GO:1900056	Biological Process	negative regulation of leaf senescence
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 100 aa Download sequence Send to blast
XRVEDMNGGG VIVSGGKDEE DDVPLPGFRF HPTDEELVGF YLRRKVEKRP ISIELIKQID 60 IYKHDPWNLP SKSYAHHVLI SWLDRPRPLL XYPKKYFYYX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00310	DAP	Transfer from AT2G43000	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027063813.1	1e-31	transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9SK55	2e-23	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	A0A068UZ64	2e-28	A0A068UZ64_COFCA; Uncharacterized protein
STRING	LPERR12G16500.1	5e-27	(Leersia perrieri)

Publications ? help Back to Top
Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]