![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_13899_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 99aa MW: 10807.9 Da PI: 8.5087 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 104.5 | 6.9e-33 | 27 | 83 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
++vrY eC+kNhAa++Gg+avDGC+Efmps geegt+aa++CaACgCHRnFHRre +
cra_locus_13899_iso_1_len_535_ver_3 27 RNVRYGECQKNHAAAVGGYAVDGCREFMPS-GEEGTTAAFNCAACGCHRNFHRREIRT 83
579**************************9.999********************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 7.0E-27 | 1 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 2.6E-30 | 28 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 1.7E-27 | 30 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.487 | 31 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MKKRQVVIRR SEDHSSRNSA NSSFTVRNVR YGECQKNHAA AVGGYAVDGC REFMPSGEEG 60 TTAAFNCAAC GCHRNFHRRE IRTEEVSEGS SPPSVSNAA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027076245.1 | 5e-50 | mini zinc finger protein 2-like | ||||
| Refseq | XP_027154448.1 | 5e-50 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 2e-40 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A068U165 | 1e-48 | A0A068U165_COFCA; Uncharacterized protein | ||||
| STRING | EOY03457 | 6e-45 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1105 | 24 | 86 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




