PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_14377_iso_4

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB_related

Protein Properties

Length: 53aa MW: 5791.49 Da PI: 9.8944

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_14377_iso_4	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.7	1.3e-13	14	52	1	39
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 +g+WT+eEd++lvd++++ G gtW++ ++ g+ R++k+ cra_locus_14377_iso_4_len_309_ver_3 14 KGAWTPEEDKILVDYINKNGHGTWRSLPKLAGLLRCGKS 52 79*****************************999985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.5E-14	5	52	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.832	9	53	IPR017930	Myb domain
SuperFamily	SSF46689	3.59E-9	9	48	IPR009057	Homeodomain-like
Pfam	PF00249	7.2E-11	14	52	IPR001005	SANT/Myb domain
CDD	cd00167	9.72E-6	16	52	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 53 aa Download sequence Send to blast
MGRSPCCDKG GVKKGAWTPE EDKILVDYIN KNGHGTWRSL PKLAGLLRCG KSX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027110329.1	2e-28	transcription factor MYB41-like
Refseq	XP_027110330.1	2e-28	transcription factor MYB41-like
Refseq	XP_027161745.1	2e-28	transcription factor MYB41-like
Swissprot	Q9S9Z2	4e-25	MYB93_ARATH; Transcription factor MYB93
TrEMBL	A0A068UAM3	1e-26	A0A068UAM3_COFCA; Uncharacterized protein
STRING	PGSC0003DMT400016394	2e-26	(Solanum tuberosum)

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]