PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_1664_iso_2

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

GRAS

Protein Properties

Length: 53aa MW: 6431.14 Da PI: 7.5265

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_1664_iso_2	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	28.1	2.5e-09	3	50	326	374
GRAS 326 pvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 ++pl++++ k ak ++ +++d + ++e+s++l++gWk+r +++S+Wr cra_locus_1664_iso_2_len_829_ver_3 3 QLPLNDEILKMAKERVKAYHKD-FVIDEDSQWLLQGWKGRIFYALSSWR 50 68999*************77.***********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03514	8.6E-7	3	50	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 53 aa Download sequence Send to blast
XEQLPLNDEI LKMAKERVKA YHKDFVIDED SQWLLQGWKG RIFYALSSWR PVY

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in plant development. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011085020.1	1e-23	scarecrow-like protein 14
Refseq	XP_011085021.1	1e-23	scarecrow-like protein 14
Refseq	XP_011085022.1	1e-23	scarecrow-like protein 14
Refseq	XP_011085023.1	1e-23	scarecrow-like protein 14
Refseq	XP_011085025.1	1e-23	scarecrow-like protein 14
Swissprot	Q9LTI5	1e-14	SCL11_ARATH; Scarecrow-like protein 11
TrEMBL	I0AZ64	1e-22	I0AZ64_9ROSI; GRAS family protein (Fragment)
TrEMBL	V4SM02	7e-22	V4SM02_9ROSI; Uncharacterized protein
STRING	XP_006435553.1	1e-22	(Citrus clementina)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]