PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_18789_iso_5

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

M-type_MADS

Protein Properties

Length: 105aa MW: 11862.6 Da PI: 10.8242

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_18789_iso_5	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.3	2.7e-30	2	52	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+ rqvtfskRrng+lKKA+ELS+LCdaev viifsstgkly+++s cra_locus_18789_iso_5_len_404_ver_3 2 KRIENKISRQVTFSKRRNGLLKKAKELSILCDAEVGVIIFSSTGKLYDFAS 52 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	28.202	1	54	IPR002100	Transcription factor, MADS-box
SMART	SM00432	9.8E-31	2	53	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-30	2	72	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.61E-39	2	71	No hit	No description
Pfam	PF00319	3.8E-27	3	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-17	16	31	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-17	31	52	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
XKRIENKISR QVTFSKRRNG LLKKAKELSI LCDAEVGVII FSSTGKLYDF ASTSMRSVIE 60 RYKKMKEEHQ QHLLNPSSEI KVLPSLARST FTNGSSLLCR AVNKG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-20	3	70	10	77	MEF2C
5f28_B	6e-20	3	70	10	77	MEF2C
5f28_C	6e-20	3	70	10	77	MEF2C
5f28_D	6e-20	3	70	10	77	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024166977.1	3e-42	MADS-box transcription factor ANR1-like isoform X6
Swissprot	Q9SZJ6	5e-36	AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBL	A0A068TMB1	2e-41	A0A068TMB1_COFCA; Uncharacterized protein
TrEMBL	A0A2G9HJJ1	2e-40	A0A2G9HJJ1_9LAMI; MADS box transcription factor
STRING	EOY15523	2e-40	(Theobroma cacao)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yu LH, et al. Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression. Mol Plant, 2017. 10(6): p. 834-845 [PMID:28438576] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128] Sun CH, et al. Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis. Plant Sci., 2018. 266: p. 27-36 [PMID:29241564]