![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_21320_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 88aa MW: 10200.6 Da PI: 8.7188 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 77 | 3e-24 | 32 | 86 | 1 | 55 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsef 55
+Cqve+C+ l+eak yhrrhkvCe+hskapvv +sg+ qrfCqqCsrf +++ f
cra_locus_21320_iso_1_len_391_ver_3 32 CCQVEDCQISLKEAKPYHRRHKVCEHHSKAPVVQMSGHPQRFCQQCSRFRNFNLF 86
6************************************************998766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 1.8E-25 | 26 | 86 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 20.315 | 30 | 88 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.27E-23 | 31 | 86 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.3E-20 | 33 | 86 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
DEDVEEENNK KKRALTLSGR RVTCAAGSTQ PCCQVEDCQI SLKEAKPYHR RHKVCEHHSK 60 APVVQMSGHP QRFCQQCSRF RNFNLFQL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 4e-17 | 25 | 86 | 3 | 64 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027159682.1 | 7e-32 | squamosa promoter-binding protein 1 | ||||
| Swissprot | Q38741 | 5e-28 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A068TTY6 | 2e-29 | A0A068TTY6_COFCA; Squamosa promoter-binding-like protein | ||||
| STRING | VIT_10s0003g00050.t01 | 5e-26 | (Vitis vinifera) | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




