![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_2597_iso_2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10282.7 Da PI: 9.8078 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 65 | 1.4e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg WT+eEd +l +++q+G+++W++I+++ g+ R++k+c++rw +yl
cra_locus_2597_iso_2_len_458_ver_3 14 RGQWTPEEDHKLTSYIAQHGTRNWRLIPKHAGLQRCGKSCRLRWTNYL 61
89********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-27 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 26.781 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.8E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.6E-19 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.01E-23 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.32E-11 | 17 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.4E-7 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MGRIPCCEKE NVKRGQWTPE EDHKLTSYIA QHGTRNWRLI PKHAGLQRCG KSCRLRWTNY 60 LRPDLKHGQF SDAEEQTIVT LHSVLGNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-17 | 11 | 88 | 4 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269|PubMed:12848824, ECO:0000269|PubMed:17727613, ECO:0000269|PubMed:21673079}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027061980.1 | 6e-59 | transcription factor MYB80-like | ||||
| Refseq | XP_027063646.1 | 6e-59 | transcription factor MYB80-like | ||||
| Refseq | XP_027170550.1 | 6e-59 | transcription factor MYB80 | ||||
| Swissprot | Q9XHV0 | 7e-55 | MYB80_ARATH; Transcription factor MYB80 | ||||
| TrEMBL | A0A3Q7IB60 | 6e-58 | A0A3Q7IB60_SOLLC; Uncharacterized protein | ||||
| TrEMBL | A0A484MR92 | 7e-58 | A0A484MR92_9ASTE; Uncharacterized protein | ||||
| TrEMBL | A0A484MT85 | 9e-58 | A0A484MT85_9ASTE; Uncharacterized protein | ||||
| STRING | Solyc10g005760.1.1 | 7e-58 | (Solanum lycopersicum) | ||||




