PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_2614_iso_3

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NAC

Protein Properties

Length: 127aa MW: 14863.1 Da PI: 9.7798

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_2614_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.2	2.4e-51	9	127	1	121
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrkn 75 lppGfrFhPtdeel+++yL +kv ++++++ +i evd++kvePwdLp k+k +ekewyfF+ +d+ky+tg r+n cra_locus_2614_iso_3_len_742_ver_3 9 LPPGFRFHPTDEELITHYLSPKVLDNSFSA-IAIGEVDLNKVEPWDLPWKAKMGEKEWYFFCVKDRKYPTGLRTN 82 79***********************999.88***********888999***************** PP NAM 76 ratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdW 121 rat++gyWkatgkdke+++ ++lvg+kktLvfy+grapkgekt+W cra_locus_2614_iso_3_len_742_ver_3 83 RATDAGYWKATGKDKEIFK-VKSLVGMKKTLVFYRGRAPKGEKTNW 127 ***************.8889******************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.09E-52	6	127	IPR003441	NAC domain
PROSITE profile	PS51005	49.952	9	127	IPR003441	NAC domain
Pfam	PF02365	9.0E-25	10	127	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
MERDEKMDLP PGFRFHPTDE ELITHYLSPK VLDNSFSAIA IGEVDLNKVE PWDLPWKAKM 60 GEKEWYFFCV KDRKYPTGLR TNRATDAGYW KATGKDKEIF KVKSLVGMKK TLVFYRGRAP 120 KGEKTNW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-46	6	127	14	135	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-46	6	127	14	135	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-46	6	127	14	135	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-46	6	127	14	135	NO APICAL MERISTEM PROTEIN
3swm_A	5e-46	6	127	17	138	NAC domain-containing protein 19
3swm_B	5e-46	6	127	17	138	NAC domain-containing protein 19
3swm_C	5e-46	6	127	17	138	NAC domain-containing protein 19
3swm_D	5e-46	6	127	17	138	NAC domain-containing protein 19
3swp_A	5e-46	6	127	17	138	NAC domain-containing protein 19
3swp_B	5e-46	6	127	17	138	NAC domain-containing protein 19
3swp_C	5e-46	6	127	17	138	NAC domain-containing protein 19
3swp_D	5e-46	6	127	17	138	NAC domain-containing protein 19
4dul_A	4e-46	6	127	14	135	NAC domain-containing protein 19
4dul_B	4e-46	6	127	14	135	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:21303842}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269\|PubMed:21303842}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027073229.1	1e-82	NAC domain-containing protein 92
Refseq	XP_027152794.1	1e-82	NAC domain-containing protein 92-like
Swissprot	Q9LJW3	1e-79	NAC59_ARATH; NAC domain-containing protein 59
TrEMBL	A0A068U1T7	4e-82	A0A068U1T7_COFCA; Uncharacterized protein
STRING	EMJ16814	9e-80	(Prunus persica)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]