PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_2781_iso_4

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

CAMTA

Protein Properties

Length: 122aa MW: 14521.7 Da PI: 9.8766

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_2781_iso_4	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	169	7.2e-53	21	122	3	104
CG-1 3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77 + ++rwl++ ei++iL n++k+++t e++ +p sgs++L++rk++ryfrkDG+sw+kkkdgktv+E+hekLKvg+ cra_locus_2781_iso_4_len_701_ver_3 21 EAQHRWLRPAEICEILRNYQKFHITPEPPLKPVSGSVFLFDRKVLRYFRKDGHSWRKKKDGKTVKEAHEKLKVGS 95 569********************************************************************** PP CG-1 78 vevlycyYahseenptfqrrcywlLee 104 +++l+cyYah+een++fqrr+yw+Le+ cra_locus_2781_iso_4_len_701_ver_3 96 IDMLHCYYAHGEENENFQRRSYWMLEQ 122 ***********************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	72.296	15	122	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	2.2E-60	18	122	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	4.6E-46	21	122	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009409	Biological Process	response to cold
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0071275	Biological Process	cellular response to aluminum ion
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MAGSGSQNLG FRLDIKQILC EAQHRWLRPA EICEILRNYQ KFHITPEPPL KPVSGSVFLF 60 DRKVLRYFRK DGHSWRKKKD GKTVKEAHEK LKVGSIDMLH CYYAHGEENE NFQRRSYWML 120 EQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00043	PBM	Transfer from AT5G64220	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027106275.1	3e-78	calmodulin-binding transcription activator 2-like isoform X1
Swissprot	Q6NPP4	4e-67	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A068TQ04	7e-77	A0A068TQ04_COFCA; Uncharacterized protein
STRING	Migut.B00609.1.p	5e-72	(Erythranthe guttata)

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]