PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2810_iso_2
Organism
Catharanthus roseus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 72aa    MW: 8211.18 Da    PI: 9.6589
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2810_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.3e-182063145
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                                        rg W + Ede+l ++v q+G+ +W++Ia++++ gR++k+c++rw+
  cra_locus_2810_iso_2_len_879_ver_3 20 RGHWRPAEDEKLRQLVDQYGPQNWNSIAEKLQ-GRSGKSCRLRWY 63
                                        899*****************************.***********8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.3521568IPR017930Myb domain
SuperFamilySSF466894.09E-151864IPR009057Homeodomain-like
SMARTSM007176.1E-131968IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-192063IPR009057Homeodomain-like
PfamPF002491.2E-172063IPR001005SANT/Myb domain
CDDcd001675.39E-142363No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MAAAAASDHI HDDDARTCPR GHWRPAEDEK LRQLVDQYGP QNWNSIAEKL QGRSGKSCRL  60
RWYYGKKAKG TI
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027093187.16e-30transcription factor MYB101-like
RefseqXP_027148060.17e-30transcription factor LAF1-like
SwissprotQ6R0C44e-23MYB52_ARATH; Transcription factor MYB52
TrEMBLA0A068UTV66e-29A0A068UTV6_COFCA; Uncharacterized protein
TrEMBLA0A2G9H6B42e-28A0A2G9H6B4_9LAMI; Transcription factor, Myb superfamily
STRINGXP_008795321.18e-28(Phoenix dactylifera)
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]
  3. Shi D, et al.
    MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage.
    Plant Physiol., 2018. 176(4): p. 2737-2749
    [PMID:29440562]