![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_31747_iso_3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 127aa MW: 14950.7 Da PI: 9.0331 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 139.7 | 1.8e-43 | 2 | 110 | 22 | 129 |
NAM 22 kvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92
k+++k+++l +vik+vd+yk+ePwdL++ k+++ e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
cra_locus_31747_iso_3_len_378_ver_3 2 KIASKRIDL-DVIKDVDLYKIEPWDLQElcKISNdEQNEWYFFSHKDKKYPTGTRTNRATIAGFWKATGRDKAV 74
788999999.99**************954555542556************************************ PP
NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
cra_locus_31747_iso_3_len_378_ver_3 75 YD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 110
**.999*****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 45.649 | 1 | 127 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.31E-45 | 2 | 126 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.0E-17 | 31 | 109 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
XKIASKRIDL DVIKDVDLYK IEPWDLQELC KISNDEQNEW YFFSHKDKKY PTGTRTNRAT 60 IAGFWKATGR DKAVYDKSKL IGMRKTLVFY KGRAPNGQKT DWIMHEYRLE SEENGPPQEE 120 GWVVCRA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-37 | 2 | 126 | 36 | 164 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028090380.1 | 5e-83 | NAC domain-containing protein 37-like | ||||
| Refseq | XP_028090381.1 | 5e-83 | NAC domain-containing protein 37-like | ||||
| Refseq | XP_028090382.1 | 5e-83 | NAC domain-containing protein 37-like | ||||
| Refseq | XP_028090383.1 | 5e-83 | NAC domain-containing protein 37-like | ||||
| Swissprot | O65508 | 5e-82 | NAC76_ARATH; NAC domain-containing protein 76 | ||||
| TrEMBL | A0A067G6T6 | 1e-81 | A0A067G6T6_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2R6RIT8 | 2e-81 | A0A2R6RIT8_ACTCH; NAC domain-containing protein | ||||
| TrEMBL | V4SNX0 | 1e-81 | V4SNX0_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006425526.1 | 3e-82 | (Citrus clementina) | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




