PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_33_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB_related

Protein Properties

Length: 109aa MW: 12600.9 Da PI: 10.1497

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_33_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.4	5.1e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ + G +W+++++ g+ R++k+c++rw +yl cra_locus_33_iso_1_len_1019_ver_3 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61 79****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.8E-21	5	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.723	9	65	IPR017930	Myb domain
SMART	SM00717	3.3E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.0E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.92E-19	15	89	IPR009057	Homeodomain-like
CDD	cd00167	4.63E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.4E-6	64	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:2000652	Biological Process	regulation of secondary cell wall biogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL SEYEEKMVID LHAQLGNRFF SSLHQTIKKC KKQEKIYGV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-15	12	89	5	81	B-MYB
1h8a_C	5e-15	12	89	25	101	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269\|PubMed:23660402}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00513	DAP	Transfer from AT5G16600	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269\|PubMed:23660402}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003519327.1	5e-62	transcription factor MYB20
Refseq	XP_028216066.1	5e-62	transcription factor MYB20-like
Swissprot	Q9C7U7	4e-58	MYB20_ARATH; Transcription factor MYB20
TrEMBL	A0A445LTL8	1e-60	A0A445LTL8_GLYSO; Transcription factor MYB20
TrEMBL	I1JHW1	1e-60	I1JHW1_SOYBN; MYB/HD-like transcription factor
STRING	GLYMA02G41180.1	2e-61	(Glycine max)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]