![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_34408_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 158aa MW: 17648.7 Da PI: 10.3077 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 56.8 | 3e-18 | 51 | 85 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +C t kTp+WR gp g+ktLCnaCG++y++ +l
cra_locus_34408_iso_1_len_579_ver_3 51 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 85
99*****************************9885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.743 | 45 | 81 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 7.3E-18 | 45 | 95 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 3.47E-16 | 46 | 109 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.0E-14 | 49 | 83 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.66E-13 | 50 | 97 | No hit | No description |
| Pfam | PF00320 | 3.9E-16 | 51 | 85 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 51 | 76 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
XITPSVSSSS ESDITTSSGK KTGKATLKKK EAAENGAGNN MVANNSEGRK CLHCATDKTP 60 QWRTGPMGPK TLCNACGVRY KSGRLVPEYR PAASPTFVLT KHSNSHRKVL ELRRQKEMLR 120 AQQHQQQFLH QNMMFDHVSN GDDYLIHQHI GPDFRQLI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022863081.1 | 8e-83 | GATA transcription factor 9-like | ||||
| Swissprot | P69781 | 2e-61 | GAT12_ARATH; GATA transcription factor 12 | ||||
| TrEMBL | A0A1U8AW42 | 3e-78 | A0A1U8AW42_NELNU; GATA transcription factor | ||||
| TrEMBL | A0A2G2YWZ5 | 2e-78 | A0A2G2YWZ5_CAPAN; GATA transcription factor 12 | ||||
| STRING | XP_010267189.1 | 6e-79 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1919 | 23 | 63 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




