![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_35121_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 98aa MW: 10444.3 Da PI: 4.4516 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 27.3 | 1e-08 | 52 | 86 | 1 | 36 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevike 36
lp+G++F+Ptd+el+ e+L++kvegk+ + + i+e
cra_locus_35121_iso_1_len_441_ver_3 52 LPAGVKFDPTDQELI-EHLEAKVEGKESKSHPLIDE 86
799************.99********9777555655 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 9.94E-7 | 48 | 90 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 9.514 | 52 | 98 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MTSSSNSQLG GSISSSSADL IDAKLEEHQL CGSKHCPGCG HKLEGKPDWV GLPAGVKFDP 60 TDQELIEHLE AKVEGKESKS HPLIDEFIPT IEGEDGIX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator involved in xylem formation (PubMed:25265867, PubMed:25535195). Promotes the expression of the secondary wall-associated transcription factor MYB46 (PubMed:25265867). Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867, PubMed:25535195). Acts as upstream regulator of NAC101/VND6 and LBD30/ASL19 (PubMed:25535195). {ECO:0000269|PubMed:25265867, ECO:0000269|PubMed:25535195}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027157140.1 | 2e-53 | NAC domain-containing protein 75-like, partial | ||||
| Refseq | XP_028058688.1 | 1e-51 | NAC domain-containing protein 75-like isoform X1 | ||||
| Refseq | XP_028058689.1 | 1e-51 | NAC domain-containing protein 75-like isoform X1 | ||||
| Refseq | XP_028058690.1 | 1e-51 | NAC domain-containing protein 75-like isoform X1 | ||||
| Refseq | XP_028058691.1 | 1e-51 | NAC domain-containing protein 75-like isoform X2 | ||||
| Swissprot | Q9M0F8 | 1e-43 | NAC75_ARATH; NAC domain-containing protein 75 | ||||
| TrEMBL | A0A2Z7BSZ3 | 3e-50 | A0A2Z7BSZ3_9LAMI; NAC domain-containing protein 8 | ||||
| STRING | Migut.K00558.1.p | 2e-48 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA4057 | 24 | 44 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




