PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_35760_iso_3

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MIKC_MADS

Protein Properties

Length: 167aa MW: 19337.4 Da PI: 10.4098

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_35760_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	88.3	4.2e-28	13	63	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELS+LCdaeva+i+fs tgkl+e+ss cra_locus_35760_iso_3_len_499_ver_3 13 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEVALIVFSATGKLFEFSS 63 68***********************************************96 PP
2	K-box	44.1	8.7e-16	93	167	17	91
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 ++++a Lkke+ e+R+l+Ge+L+ L ++eL +Le+ +e +l+++ + K e ++++i +l+kke +l+ee cra_locus_35760_iso_3_len_499_ver_3 93 ENHNHALLKKELMGKTLELRQLKGEELQGLGMEELIKLEKMIEAGLNRVTKSKGEKYIKEITNLKKKEAQLREE 166 5677788888888888899******************************************************9 PP K-box 91 n 91 n cra_locus_35760_iso_3_len_499_ver_3 167 N 167 8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.6E-39	5	64	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.618	5	65	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-27	7	27	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-30	7	78	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	7	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.07E-38	7	79	No hit	No description
Pfam	PF00319	2.5E-25	14	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-27	27	42	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-27	42	63	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	11.113	90	167	IPR002487	Transcription factor, K-box
Pfam	PF01486	5.0E-12	95	167	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
XRKKMVRQKI QIKKIDNLTA RQVTFSKRRR GLFKKAQELS TLCDAEVALI VFSATGKLFE 60 FSSSSMMQVI DRHGIYSKNY DKQDNPPLLP QCENHNHALL KKELMGKTLE LRQLKGEELQ 120 GLGMEELIKL EKMIEAGLNR VTKSKGEKYI KEITNLKKKE AQLREEN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	7e-21	5	97	1	93	MEF2 CHIMERA
6byy_B	7e-21	5	97	1	93	MEF2 CHIMERA
6byy_C	7e-21	5	97	1	93	MEF2 CHIMERA
6byy_D	7e-21	5	97	1	93	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25132385}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18694458}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027160324.1	3e-78	MADS-box protein SVP-like isoform X1
Refseq	XP_027160325.1	3e-78	MADS-box protein SVP-like isoform X1
Refseq	XP_027160326.1	3e-78	MADS-box protein SVP-like isoform X1
Refseq	XP_027160328.1	1e-78	MADS-box protein SVP-like isoform X3
Swissprot	Q9FVC1	1e-64	SVP_ARATH; MADS-box protein SVP
TrEMBL	X5D5Y5	6e-77	X5D5Y5_COFAR; SVP-3
STRING	XP_009802200.1	5e-73	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA938	23	77

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Jaudal M, et al. Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago. J. Exp. Bot., 2014. 65(2): p. 429-42 [PMID:24249713] Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana. Plant Cell, 2014. 26(6): p. 2457-2471 [PMID:24920331] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Bechtold U, et al. Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis. Plant Cell, 2016. 28(2): p. 345-66 [PMID:26842464] Fernández V,Takahashi Y,Le Gourrierec J,Coupland G Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days. Plant J., 2016. 86(5): p. 426-40 [PMID:27117775] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Zou YP, et al. Adaptation of Arabidopsis thaliana to the Yangtze River basin. Genome Biol., 2017. 18(1): p. 239 [PMID:29284515] Richter R, et al. Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications. PLoS Genet., 2019. 15(4): p. e1008065 [PMID:30946745]