![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_38068_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 53aa MW: 6331.1 Da PI: 10.1461 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 37.5 | 6e-12 | 1 | 35 | 51 | 86 |
trihelix 51 kekwenlnkrykkikegekkrtsessstcpyfdqle 86
kekwen+nk+++k+k+++kkr s +s+tcpyf+ql
cra_locus_38068_iso_1_len_301_ver_3 1 KEKWENINKYFRKTKDSKKKR-SMDSRTCPYFQQLS 35
79******************8.88899*******96 PP
| |||||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 53 aa Download sequence Send to blast |
KEKWENINKY FRKTKDSKKK RSMDSRTCPY FQQLSSLYSQ GTLVGPSDEP ENR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012492854.1 | 7e-25 | PREDICTED: trihelix transcription factor GTL2 isoform X2 | ||||
| Refseq | XP_016668746.1 | 8e-25 | PREDICTED: trihelix transcription factor GTL2-like isoform X2 | ||||
| Refseq | XP_017630950.1 | 7e-25 | PREDICTED: trihelix transcription factor GTL2 | ||||
| Swissprot | Q8H181 | 6e-17 | GTL2_ARATH; Trihelix transcription factor GTL2 | ||||
| TrEMBL | A0A0B0N7D5 | 2e-23 | A0A0B0N7D5_GOSAR; Uncharacterized protein | ||||
| TrEMBL | A0A0D2SL93 | 2e-23 | A0A0D2SL93_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8HRX8 | 2e-23 | A0A1U8HRX8_GOSHI; trihelix transcription factor GTL2-like isoform X2 | ||||
| STRING | Gorai.007G283800.1 | 3e-24 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA13700 | 10 | 13 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




