PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_43336_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

HSF

Protein Properties

Length: 77aa MW: 8830.96 Da PI: 4.407

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_43336_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	65.9	8.9e-21	25	77	2	54
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFv 54 Fl+k+y++++d+++++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFv cra_locus_43336_iso_1_len_345_ver_3 25 FLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFV 77 9***************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	7.9E-23	17	77	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.2E-11	21	77	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	3.27E-19	22	77	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.5E-12	25	48	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	3.8E-17	25	77	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.5E-12	63	75	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
MALMLDNCEG ILLSLDSHKS VPAPFLTKTY QLVDDPSTDH IVSWGEDDTT FVVWRPPEFA 60 RDLLPNYFKH NNFSSFV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5hdg_A	1e-12	21	77	7	62	Heat shock factor protein 1
5hdn_A	1e-12	21	77	7	62	Heat shock factor protein 1
5hdn_B	1e-12	21	77	7	62	Heat shock factor protein 1
5hdn_C	1e-12	21	77	7	62	Heat shock factor protein 1
5hdn_D	1e-12	21	77	7	62	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006354868.1	2e-49	PREDICTED: heat stress transcription factor B-4
Refseq	XP_022940704.1	6e-50	heat stress transcription factor B-4-like, partial
Swissprot	Q7XHZ0	4e-37	HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBL	A0A068U135	9e-49	A0A068U135_COFCA; Uncharacterized protein
TrEMBL	A0A2G2VBY3	2e-48	A0A2G2VBY3_CAPBA; Heat stress transcription factor B-4
TrEMBL	A0A2G2Y0E5	2e-48	A0A2G2Y0E5_CAPAN; Heat stress transcription factor B-4
TrEMBL	A0A2G3CQ07	2e-48	A0A2G3CQ07_CAPCH; Heat stress transcription factor B-4
STRING	Aquca_015_00048.1	5e-49	(Aquilegia coerulea)
STRING	evm.model.supercontig_49.32	3e-50	(Carica papaya)
STRING	PGSC0003DMT400020554	8e-49	(Solanum tuberosum)
STRING	XP_010112180.1	8e-49	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2721	24	50

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]