PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_46335_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB_related

Protein Properties

Length: 99aa MW: 11318.8 Da PI: 11.0389

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_46335_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.6	1.9e-15	15	54	3	44
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++++eE+ +d+ +q+G++ W++Ia +++ gRt++++k++w cra_locus_46335_iso_1_len_297_ver_3 15 KFSAEEERTVIDLQAQFGNK-WAKIATYLP-GRTDNDVKNFW 54 89****************.*****.********* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.45E-16	1	65	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.8E-19	2	60	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.407	7	62	IPR017930	Myb domain
SMART	SM00717	8.2E-13	12	60	IPR001005	SANT/Myb domain
CDD	cd00167	1.37E-10	15	54	No hit	No description
Pfam	PF00249	1.4E-13	15	54	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
RWVNKLRPNL KNGVKFSAEE ERTVIDLQAQ FGNKWAKIAT YLPGRTDNDV KNFWSSRQKR 60 LARILQTPSS SSSSNKSQKS SKHVLAIHDV PYLETSKFG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269\|PubMed:15618418, ECO:0000269\|PubMed:15694308, ECO:0000269\|PubMed:19300502, ECO:0000269\|PubMed:21285328, ECO:0000269\|PubMed:24876252}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269\|PubMed:21441434, ECO:0000269\|PubMed:25057814}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027106540.1	1e-50	transcription factor DUO1-like
Refseq	XP_027112927.1	1e-50	transcription factor DUO1-like
Refseq	XP_027160096.1	1e-50	transcription factor DUO1
Swissprot	A0A178VEK7	9e-38	DUO1_ARATH; Transcription factor DUO1
TrEMBL	A0A068UMH9	3e-49	A0A068UMH9_COFCA; Uncharacterized protein
STRING	XP_008356546.1	8e-47	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4207	23	42

Publications ? help Back to Top
Zheng B,He H,Zheng Y,Wu W,McCormick S An ARID domain-containing protein within nuclear bodies is required for sperm cell formation in Arabidopsis thaliana. PLoS Genet., 2014. 10(7): p. e1004421 [PMID:25057814] Peters B, et al. A Conserved cis-Regulatory Module Determines Germline Fate through Activation of the Transcription Factor DUO1 Promoter. Plant Physiol., 2017. 173(1): p. 280-293 [PMID:27624837] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145]