PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_4641_iso_8

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

YABBY

Protein Properties

Length: 234aa MW: 25903.1 Da PI: 7.9361

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_4641_iso_8	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	228.2	2.2e-70	27	191	6	170
YABBY 6 sseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkvee 79 seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++ a + +++++l + ++ + cra_locus_4641_iso_8_len_2756_ver_3 27 PSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQLNFGHNLFSTHPHNFLEQI 100 68**************************************88776665555555566777777778888888 PP YABBY 80 enlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreaf 153 +n + n +++++++ + + + +++pr+p +rPPekrqr+Psaynrfikeeiqrika+nPdishreaf cra_locus_4641_iso_8_len_2756_ver_3 101 SNPTPNFLMNHHQTSATDFNLAAQPGFDDLPRPPVLNRPPEKRQRIPSAYNRFIKEEIQRIKAGNPDISHREAF 174 888889999999988888877788999*999*********************************** PP YABBY 154 saaaknWahfPkihfgl 170 saaaknWahfP+i fgl cra_locus_4641_iso_8_len_2756_ver_3 175 SAAAKNWAHFPHIQFGL 191 *************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.8E-69	27	191	IPR006780	YABBY protein
SuperFamily	SSF47095	9.69E-8	136	185	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	1.1E-4	139	185	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development
GO:0033014	Biological Process	tetrapyrrole biosynthetic process
GO:0009570	Cellular Component	chloroplast stroma
GO:0009941	Cellular Component	chloroplast envelope
GO:0008483	Molecular Function	transaminase activity
GO:0030170	Molecular Function	pyridoxal phosphate binding
GO:0042286	Molecular Function	glutamate-1-semialdehyde 2,1-aminomutase activity

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MSSSSSSSNS NSNSSTSLSL DHLTPPPSEQ LCYVHCNICD TVLAVSVPCT SLFKTVTVRC 60 GHCTNLLPVN MRGLLLPSAN QLNFGHNLFS THPHNFLEQI SNPTPNFLMN HHQTSATDFN 120 LAAQPGFDDL PRPPVLNRPP EKRQRIPSAY NRFIKEEIQR IKAGNPDISH REAFSAAAKN 180 WAHFPHIQFG LMPDHQTHVK KNNNVIRQQD GGEDHVLMKD GGFFATANVG VSPY

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.
UniProt	Seems to be associated with phloem cell differentiation. {ECO:0000269\|PubMed:17676337}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002266233.1	1e-118	PREDICTED: protein YABBY 4
Swissprot	A2X7Q3	5e-76	YAB4_ORYSI; Protein YABBY 4
Swissprot	O22152	2e-76	YAB1_ARATH; Axial regulator YABBY 1
Swissprot	Q6H668	5e-76	YAB4_ORYSJ; Protein YABBY 4
TrEMBL	A0A438K3E8	1e-116	A0A438K3E8_VITVI; Axial regulator YABBY 1
TrEMBL	D7TN10	1e-116	D7TN10_VITVI; Uncharacterized protein
STRING	VIT_02s0154g00070.t01	1e-117	(Vitis vinifera)

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Yang C,Ma Y,Li J The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway. J. Exp. Bot., 2016. 67(18): p. 5545-5556 [PMID:27578842] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]