![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_46730_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 116aa MW: 13445.6 Da PI: 10.4488 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 75.9 | 1.2e-23 | 69 | 116 | 3 | 50 |
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieW 50
g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk ++W
cra_locus_46730_iso_1_len_347_ver_3 69 GGKDRHSKVCTVRGLRDRRIRLSVPTAIQLYDLQDRLGLNQPSKVVDW 116
78********************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 26.591 | 70 | 116 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 4.8E-22 | 70 | 116 | IPR005333 | Transcription factor, TCP |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009965 | Biological Process | leaf morphogenesis | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045962 | Biological Process | positive regulation of development, heterochronic | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
XQVDIMNSKE QQDHHYHHQY QTKEEGDHPS DNYNKLSKTS SNPNPSSSSR QWGGGFRNPR 60 IVRVSRTFGG KDRHSKVCTV RGLRDRRIRL SVPTAIQLYD LQDRLGLNQP SKVVDW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 1e-15 | 75 | 116 | 1 | 42 | Putative transcription factor PCF6 |
| 5zkt_B | 1e-15 | 75 | 116 | 1 | 42 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00065 | PBM | Transfer from AT5G60970 | Download |
| |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027102341.1 | 2e-42 | transcription factor TCP5-like isoform X2 | ||||
| Swissprot | Q9FME3 | 2e-37 | TCP5_ARATH; Transcription factor TCP5 | ||||
| TrEMBL | A0A068V843 | 2e-41 | A0A068V843_COFCA; Uncharacterized protein | ||||
| STRING | Cagra.0083s0006.1.p | 6e-42 | (Capsella grandiflora) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA821 | 24 | 99 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




