PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_5081_iso_3

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NAC

Protein Properties

Length: 61aa MW: 7076.79 Da PI: 4.2508

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_5081_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	64.5	3.3e-20	6	56	1	52
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52 lppGfrFhPtdeel+++yLk++++++++++ ++i+evdiyk++Pw+Lp+k++ cra_locus_5081_iso_3_len_465_ver_3 6 LPPGFRFHPTDEELIMYYLKNQATSRPCPV-SIIPEVDIYKFDPWELPEKTE 56 79**************************.89*************6554 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.01E-22	5	59	IPR003441	NAC domain
PROSITE profile	PS51005	22.333	6	61	IPR003441	NAC domain
Pfam	PF02365	1.0E-8	7	48	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009825	Biological Process	multidimensional cell growth
GO:0009835	Biological Process	fruit ripening
GO:0009908	Biological Process	flower development
GO:0010150	Biological Process	leaf senescence
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MVGGNLPPGF RFHPTDEELI MYYLKNQATS RPCPVSIIPE VDIYKFDPWE LPEKTEFGEN 60 X

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	5e-20	5	58	14	67	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269\|PubMed:29760199}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00221	DAP	Transfer from AT1G69490	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269\|PubMed:29760199}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011070984.1	2e-32	NAC transcription factor 29
Refseq	XP_028086269.1	2e-32	NAC domain-containing protein 2-like
Swissprot	K4BNG7	2e-32	NAP2_SOLLC; NAC domain-containing protein 2
TrEMBL	A0A2Z5HW71	1e-31	A0A2Z5HW71_IPOBA; NAC3 protein
STRING	XP_009781251.1	2e-31	(Nicotiana sylvestris)
STRING	XP_009598866.1	2e-31	(Nicotiana tomentosiformis)

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Ma X, et al. The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato. Plant Physiol., 2018. 177(3): p. 1286-1302 [PMID:29760199]