PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_5160_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB_related

Protein Properties

Length: 88aa MW: 10395.1 Da PI: 10.4189

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_5160_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.4	9e-15	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l ++ ++G +W+ ++ g+ R++k+c++rw++yl cra_locus_5160_iso_1_len_411_ver_3 14 KGAWSEEEDNKLRAYILRYGHWNWRQLPKFAGLARCGKSCRLRWLNYL 61 79****************99***********************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.1E-22	6	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.691	9	65	IPR017930	Myb domain
SMART	SM00717	1.3E-9	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-13	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.43E-22	15	88	IPR009057	Homeodomain-like
CDD	cd00167	7.51E-8	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.3E-9	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	9.505	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MVRSPSIDKN GLRKGAWSEE EDNKLRAYIL RYGHWNWRQL PKFAGLARCG KSCRLRWLNY 60 LKPGLKRGPI TEEEEEMIVK LHEKLGNK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-13	12	88	25	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:19517001, ECO:0000305\|PubMed:12857823}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:12857823, ECO:0000269\|PubMed:19517001, ECO:0000269\|PubMed:8980549}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019158785.1	2e-50	PREDICTED: myb-related protein 308-like
Swissprot	Q9LDR8	7e-36	MY102_ARATH; Transcription factor MYB102
TrEMBL	A0A343CX97	2e-55	A0A343CX97_CATRO; Myb17501
STRING	EOX99263	2e-44	(Theobroma cacao)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615] Zhu L,Guo J,Ma Z,Wang J,Zhou C Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis. Biomolecules, 2019. [PMID:29880735]