![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_54477_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 99aa MW: 11387.2 Da PI: 11.4778 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 53.1 | 4.4e-17 | 1 | 35 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs C+tt TplWR gp g+++ CnaCG++y kk++
cra_locus_54477_iso_1_len_295_ver_3 1 CSDCKTTRTPLWRGGPAGPRSMCNACGIKYHKKRR 35
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:3.30.50.10 | 2.8E-14 | 1 | 36 | IPR013088 | Zinc finger, NHR/GATA-type |
| SuperFamily | SSF57716 | 2.09E-11 | 1 | 37 | No hit | No description |
| Pfam | PF00320 | 1.5E-15 | 1 | 35 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 1 | 26 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.4 | 1 | 30 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 3.29E-11 | 1 | 52 | No hit | No description |
| SMART | SM00401 | 4.5E-7 | 1 | 52 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
CSDCKTTRTP LWRGGPAGPR SMCNACGIKY HKKRRQHLGL DTGKIIRKKK RSSDNRRSKV 60 REILKMQFMA LRSDSVLHRS GKLMSKLREE EQAAVLLMX |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 32 | 50 | KRRQHLGLDTGKIIRKKKR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011079598.1 | 2e-50 | GATA transcription factor 15 | ||||
| Swissprot | Q8LG10 | 1e-22 | GAT15_ARATH; GATA transcription factor 15 | ||||
| TrEMBL | A0A2G9G6U2 | 6e-50 | A0A2G9G6U2_9LAMI; Uncharacterized protein | ||||
| STRING | Migut.D00108.1.p | 1e-47 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA8503 | 22 | 29 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




