![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_560_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 136aa MW: 15675.9 Da PI: 10.1419 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 83.9 | 2.6e-26 | 14 | 65 | 1 | 53 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRg 53
+ep+YVNaKQy++Il+RRq+Rak+e ekk+ +k rkpylheSRh+hA + +g
cra_locus_560_iso_1_len_1142_ver_3 14 EEPVYVNAKQYHGILRRRQSRAKAEMEKKV-IKVRKPYLHESRHQHAXEKSKG 65
69****************************.****************988766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 2.0E-25 | 12 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 28.275 | 13 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.3E-21 | 15 | 62 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 6.5E-19 | 16 | 38 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 18 | 38 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 6.5E-19 | 47 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MPQTRVPLPI PMEEEPVYVN AKQYHGILRR RQSRAKAEME KKVIKVRKPY LHESRHQHAX 60 EKSKGIWRPF SQYKEDPHLK HLAASTAPMT GHLNTNSQME LVGHSIMLTT YPYADPQYGA 120 LMTYGAPVHP QLFGMP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 6e-17 | 14 | 80 | 2 | 70 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028776987.1 | 2e-31 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
| Refseq | XP_028776988.1 | 2e-31 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
| Refseq | XP_028796874.1 | 2e-31 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
| Refseq | XP_028796875.1 | 2e-31 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
| Swissprot | Q945M9 | 4e-25 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
| TrEMBL | A0A1Q3BGG8 | 3e-29 | A0A1Q3BGG8_CEPFO; CBFB_NFYA domain-containing protein | ||||
| TrEMBL | A0A2N9I0S9 | 1e-29 | A0A2N9I0S9_FAGSY; Uncharacterized protein | ||||
| TrEMBL | G0ZAK9 | 3e-29 | G0ZAK9_POPEU; CCAAT-binding transcription factor subunit B | ||||
| STRING | XP_006482871.1 | 4e-29 | (Citrus sinensis) | ||||
| STRING | XP_008790783.1 | 6e-29 | (Phoenix dactylifera) | ||||
| STRING | XP_006439109.1 | 4e-29 | (Citrus clementina) | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




