PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_6519_iso_4

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

WRKY

Protein Properties

Length: 104aa MW: 11845.3 Da PI: 10.2473

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_6519_iso_4	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	70.1	3.2e-22	41	99	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr ++ pvkk+ver++edpk+v++ Yeg Hnh+ cra_locus_6519_iso_4_len_908_ver_3 41 LDDGYKWRKYGKKMVKNSPNPRITTDAQLKDAPVKKRVERDKEDPKYVITAYEGIHNHQ 99 59********************999999**************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.1E-25	26	101	IPR003657	WRKY domain
SuperFamily	SSF118290	2.88E-19	33	101	IPR003657	WRKY domain
PROSITE profile	PS50811	24.076	36	101	IPR003657	WRKY domain
SMART	SM00774	5.4E-20	41	100	IPR003657	WRKY domain
Pfam	PF03106	2.4E-16	42	99	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
SLQQHEGEGL TLTSRDQSGS GSRVGKKEKV AFRTKSQVEI LDDGYKWRKY GKKMVKNSPN 60 PRITTDAQLK DAPVKKRVER DKEDPKYVIT AYEGIHNHQG PSQY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	8e-20	25	102	1	78	Probable WRKY transcription factor 4
2lex_A	8e-20	25	102	1	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027085251.1	2e-40	probable WRKY transcription factor 50
Refseq	XP_027085414.1	2e-40	probable WRKY transcription factor 50
Refseq	XP_027182807.1	2e-40	probable WRKY transcription factor 50
Swissprot	Q8VWQ5	5e-31	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A068UIE4	3e-39	A0A068UIE4_COFCA; Uncharacterized protein
STRING	XP_009594857.1	6e-39	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2124	24	62

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]