PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6581_iso_2
Organism
Catharanthus roseus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 105aa    MW: 11947.8 Da    PI: 8.9888
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6581_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-183178148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  cra_locus_6581_iso_2_len_410_ver_3 31 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 78
                                        79******************************99************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-252281IPR009057Homeodomain-like
PROSITE profilePS5129425.0752682IPR017930Myb domain
SMARTSM007172.4E-143080IPR001005SANT/Myb domain
PfamPF002493.8E-173178IPR001005SANT/Myb domain
SuperFamilySSF466893.22E-2232105IPR009057Homeodomain-like
CDDcd001673.23E-123378No hitNo description
Gene3DG3DSA:1.10.10.604.5E-782105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
KSTHKVEEAE EKEIIINMGR PPCCDKVGIK KGPWTPEEDI ILVSYIQEHG PGNWRSVPTN  60
TGLLRCSKSC RLRWTNYLRP GIKRGNFTPH EEGMIIHLQA LLGNK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}.
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:21637967}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:21637967, ECO:0000269|PubMed:23453954, ECO:0000269|PubMed:23828545, ECO:0000269|PubMed:9839469}.
UniProtINDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006484863.12e-62myb-related protein 306
RefseqXP_012465520.12e-62PREDICTED: myb-related protein 306-like
SwissprotB3VTV73e-62MYB60_VITVI; Transcription factor MYB60
SwissprotQ8GYP53e-62MYB60_ARATH; Transcription factor MYB60
TrEMBLA0A0D2VHT34e-61A0A0D2VHT3_GOSRA; Uncharacterized protein
STRINGGorai.013G196800.17e-62(Gossypium raimondii)
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Galbiati M, et al.
    Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells.
    Plant J., 2008. 53(5): p. 750-62
    [PMID:18036199]
  3. Rusconi F, et al.
    The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells.
    J. Exp. Bot., 2013. 64(11): p. 3361-71
    [PMID:23828545]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Kim D,Ntui VO,Xiong L
    Arabidopsis YAK1 regulates abscisic acid response and drought resistance.
    FEBS Lett., 2016. 590(14): p. 2201-9
    [PMID:27264339]