![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_69402_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 87aa MW: 9557.62 Da PI: 10.5434 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 99 | 1e-30 | 13 | 70 | 106 | 163 |
YABBY 106 deevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
+ ++p++p v++PPek+ r Psaynrf+k+eiqrika+nP+i hreafsaaaknWa +
cra_locus_69402_iso_1_len_287_ver_3 13 EPSSPKAPFVVKPPEKKHRLPSAYNRFMKDEIQRIKAANPEIPHREAFSAAAKNWARY 70
456899999***********************************************75 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 6.5E-30 | 14 | 70 | IPR006780 | YABBY protein |
| SuperFamily | SSF47095 | 1.15E-9 | 14 | 69 | IPR009071 | High mobility group box domain |
| Gene3D | G3DSA:1.10.30.10 | 9.3E-6 | 24 | 69 | IPR009071 | High mobility group box domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
ASCXTALPIS SSEPSSPKAP FVVKPPEKKH RLPSAYNRFM KDEIQRIKAA NPEIPHREAF 60 SAAAKNWARY IPNTPQGPPP ASSNNNM |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016505118.1 | 1e-41 | PREDICTED: protein CRABS CLAW-like, partial | ||||
| Swissprot | Q8L925 | 1e-31 | CRC_ARATH; Protein CRABS CLAW | ||||
| TrEMBL | A0A1S4CVI4 | 3e-40 | A0A1S4CVI4_TOBAC; protein CRABS CLAW-like | ||||
| STRING | VIT_01s0011g00140.t01 | 2e-38 | (Vitis vinifera) | ||||
| STRING | XP_009600446.1 | 4e-38 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA5210 | 23 | 39 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




