PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_70089_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NF-YB

Protein Properties

Length: 93aa MW: 10678.3 Da PI: 8.1899

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_70089_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	183.2	2.1e-57	2	93	2	93
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfe 77 +eqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe cra_locus_70089_iso_1_len_279_ver_3 2 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFE 77 89************************************************************************ PP NF-YB 78 dyveplkvylkkyrel 93 +yveplkvyl+kyre+ cra_locus_70089_iso_1_len_279_ver_3 78 EYVEPLKVYLAKYREM 93 ************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.1E-52	2	93	IPR009072	Histone-fold
SuperFamily	SSF47113	2.17E-39	4	93	IPR009072	Histone-fold
Pfam	PF00808	9.6E-29	7	71	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.0E-22	35	53	No hit	No description
PROSITE pattern	PS00685	0	38	54	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	5.0E-22	54	72	No hit	No description
PRINTS	PR00615	5.0E-22	73	91	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
SKEQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS EFISFVTGEA SDKCQREKRK 60 TINGDDLLWA MTTLGFEEYV EPLKVYLAKY REM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-48	2	92	2	92	Transcription factor HapC (Eurofung)
4g92_B	2e-48	2	92	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011100345.1	6e-66	nuclear transcription factor Y subunit B-3
Swissprot	O23310	6e-62	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A2G9HCD2	1e-63	A0A2G9HCD2_9LAMI; CCAAT-binding factor, subunit A (HAP3)
STRING	XP_009622977.1	3e-62	(Nicotiana tomentosiformis)
STRING	XP_004305679.1	4e-62	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]