![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_76806_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 103aa MW: 11549 Da PI: 10.4695 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 73 | 5.1e-23 | 43 | 102 | 1 | 60 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsat 60
s++k+kaal+ ++v+p+f +l+sg +kl+r G+++l++ +a++er+ydW+k+q+falsat
cra_locus_76806_iso_1_len_308_ver_3 43 SIFKGKAALSAEPVMPKFIKLESGGFKLERCGTIMLTFWPAIGERRYDWDKRQKFALSAT 102
79********************************************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 1.0E-27 | 32 | 102 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 5.96E-24 | 37 | 102 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 3.1E-21 | 44 | 102 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
LFGESTNNSK LWRGMTTQTN ISTANPNLSR YGESAAKVFA PYSIFKGKAA LSAEPVMPKF 60 IKLESGGFKL ERCGTIMLTF WPAIGERRYD WDKRQKFALS ATX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3n1h_A | 9e-32 | 32 | 102 | 5 | 75 | StWhy2 |
| 3n1i_A | 9e-32 | 32 | 102 | 5 | 75 | protein StWhy2 |
| 3n1j_A | 9e-32 | 32 | 102 | 5 | 75 | Protein StWhy2 |
| 3n1k_A | 9e-32 | 32 | 102 | 5 | 75 | protein StWhy2 |
| 3n1l_A | 9e-32 | 32 | 102 | 5 | 75 | protein StWhy2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011095185.1 | 1e-43 | single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 | ||||
| Swissprot | D9J034 | 5e-32 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A022Q835 | 1e-41 | A0A022Q835_ERYGU; Uncharacterized protein | ||||
| STRING | Migut.C01402.1.p | 2e-42 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA9782 | 22 | 28 |




