PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_77219_iso_2

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB_related

Protein Properties

Length: 94aa MW: 11113.3 Da PI: 11.1669

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_77219_iso_2	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.8	5e-18	23	66	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++ cra_locus_77219_iso_2_len_280_ver_3 23 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 66 8999****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.3E-21	3	75	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	4.4E-8	3	29	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.831	18	72	IPR017930	Myb domain
SMART	SM00717	3.4E-15	22	70	IPR001005	SANT/Myb domain
Pfam	PF00249	7.8E-17	23	66	IPR001005	SANT/Myb domain
CDD	cd00167	5.64E-12	27	66	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.7E-21	30	68	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009740	Biological Process	gibberellic acid mediated signaling pathway
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0080086	Biological Process	stamen filament development
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
GLKRTGKSCR LRRLNYLRPD VRRGNITPEE QLLIMELHAK WGNRWSKIAK HLPGRTDNEI 60 KNFWRTRIQK HMKQGDDSNF NGQNDNHSND QASX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-16	4	72	40	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269\|PubMed:11967090, ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21447791}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate. {ECO:0000269\|PubMed:16805732}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011468270.1	1e-53	PREDICTED: myb-related protein 305-like
Swissprot	Q9LK95	4e-50	MYB21_ARATH; Transcription factor MYB21
TrEMBL	A0A2P6S5K0	4e-52	A0A2P6S5K0_ROSCH; Putative transcription factor MYB-HB-like family
STRING	XP_004304632.1	5e-53	(Fragaria vesca)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Su Z, et al. Flower development under drought stress: morphological and transcriptomic analyses reveal acute responses and long-term acclimation in Arabidopsis. Plant Cell, 2013. 25(10): p. 3785-807 [PMID:24179129] Liu Z, et al. A Conserved Cytochrome P450 Evolved in Seed Plants Regulates Flower Maturation. Mol Plant, 2015. 8(12): p. 1751-65 [PMID:26388305] Chen X,Huang H,Qi T,Liu B,Song S New perspective of the bHLH-MYB complex in jasmonate-regulated plant fertility in arabidopsis. Plant Signal Behav, 2016. 11(2): p. e1135280 [PMID:26829586] Huang H, et al. Arabidopsis MYB24 Regulates Jasmonate-Mediated Stamen Development. Front Plant Sci, 2017. 8: p. 1525 [PMID:28928760]