![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | cra_locus_78031_iso_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 122aa MW: 13761.2 Da PI: 10.1007 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 34.6 | 3.2e-11 | 51 | 100 | 3 | 52 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52
R +++k q+e+Le+++++++ p+ +++ + + ++L++++V WF +R
cra_locus_78031_iso_1_len_363_ver_3 51 ARKRLKKVQVETLEQVYRRTKRPTNTMISSIVHVTNLPKKRVVKWFEDKR 100
58999*****************************************9998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 10.155 | 46 | 100 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.07E-10 | 47 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 4.5E-5 | 48 | 110 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 1.44E-8 | 49 | 100 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.1E-10 | 50 | 100 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 7.3E-9 | 51 | 100 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 122 aa Download sequence Send to blast |
XMSAALSDKP VSAISEPVEE PMEALETLQP AANSEAGKKV PVHVMQSNWS ARKRLKKVQV 60 ETLEQVYRRT KRPTNTMISS IVHVTNLPKK RVVKWFEDKR GEDGVPETRV PYQKPADADQ 120 TX |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 50 | 58 | ARKRLKKVQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020551126.1 | 3e-52 | protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 | ||||
| Swissprot | Q8H0V5 | 1e-34 | OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 | ||||
| TrEMBL | A0A2G9I2J7 | 7e-53 | A0A2G9I2J7_9LAMI; Uncharacterized protein | ||||
| STRING | VIT_04s0008g05190.t01 | 1e-47 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA9428 | 23 | 27 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




