PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_7992_iso_2

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

Dof

Protein Properties

Length: 108aa MW: 12248.5 Da PI: 10.2456

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_7992_iso_2	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	131.9	1.7e-41	37	98	2	63
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss cra_locus_7992_iso_2_len_507_ver_3 37 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 98 6899******************************************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	8.0E-30	25	95	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	4.3E-35	39	95	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.646	41	95	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	43	79	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005730	Cellular Component	nucleolus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 108 aa Download sequence Send to blast
MDPSSAQHHH QEMSSQTLES MLVCTKAQQD QKKPRPPEQA LKCPRCDSTN TKFCYYNNYS 60 LSQPRYFCKS CRRYWTKGGT LRNVPVGGGC RKNKRSSSSS SSSSKRGX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250\|UniProtKB:Q9M2U1, ECO:0000269\|PubMed:30626969}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269\|PubMed:20220754, ECO:0000269\|PubMed:30626969}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027086754.1	3e-62	dof zinc finger protein DOF2.1-like
Refseq	XP_027108486.1	3e-62	dof zinc finger protein DOF2.1-like
Refseq	XP_027150703.1	3e-62	dof zinc finger protein DOF2.1-like
Swissprot	Q84TE9	2e-42	DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBL	A0A068UK67	4e-61	A0A068UK67_COFCA; Uncharacterized protein
STRING	XP_009777851.1	7e-61	(Nicotiana sylvestris)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]