PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_8513_iso_3

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NF-YA

Protein Properties

Length: 59aa MW: 6977.15 Da PI: 11.2557

Description

NF-YA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_8513_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CBFB_NFYA	70	5.4e-22	18	59	2	44
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRh 44 p+YVN KQ+++Il+RRq+Rakle+++k+ +ksrkpylheSRh cra_locus_8513_iso_3_len_292_ver_3 18 VPVYVNTKQFRAILRRRQMRAKLEAQNKI-AKSRKPYLHESRH 59 59*************************.**********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00521	9.4E-14	15	59	IPR001289	Nuclear transcription factor Y subunit A
PROSITE profile	PS51152	25.744	16	59	IPR001289	Nuclear transcription factor Y subunit A
Pfam	PF02045	3.1E-18	19	59	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	2.3E-14	19	41	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	2.3E-14	50	59	IPR001289	Nuclear transcription factor Y subunit A

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MGFNQARVPI PLDCAEDVPV YVNTKQFRAI LRRRQMRAKL EAQNKIAKSR KPYLHESRH

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015865962.1	9e-25	nuclear transcription factor Y subunit A-3
Refseq	XP_015865980.1	9e-25	nuclear transcription factor Y subunit A-3
Refseq	XP_024932654.1	9e-25	nuclear transcription factor Y subunit A-3
Swissprot	Q84JP1	7e-21	NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
Swissprot	Q9LNP6	1e-20	NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBL	A0A1U7XW64	2e-23	A0A1U7XW64_NICSY; nuclear transcription factor Y subunit A-4-like isoform X2
TrEMBL	M0ZH83	3e-24	M0ZH83_SOLTU; Uncharacterized protein
STRING	XP_009793846.1	4e-24	(Nicotiana sylvestris)
STRING	XP_009801470.1	4e-24	(Nicotiana sylvestris)

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Djami-Tchatchou AT,Ntushelo K Expression Profile of Stress-responsive Arabidopsis thaliana miRNAs and their Target Genes in Response to Inoculation with Pectobacterium carotovorum subsp. carotovorum. Pak. J. Biol. Sci., 2017. 20(3): p. 147-153 [PMID:29023006]