PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_94_iso_3

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB_related

Protein Properties

Length: 128aa MW: 14813.7 Da PI: 10.6961

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_94_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	65.7	8.5e-21	14	59	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + cra_locus_94_iso_3_len_769_ver_3 14 KGPWSPEEDELLQQLVQKHGPRNWSLISKSIQ-GRSGKSCRLRWCNQ 59 79****************************.*********985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	27.759	9	64	IPR017930	Myb domain
SuperFamily	SSF46689	5.74E-20	11	86	IPR009057	Homeodomain-like
SMART	SM00717	2.0E-17	13	62	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-20	14	59	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.4E-23	14	63	IPR009057	Homeodomain-like
CDD	cd00167	9.28E-16	16	58	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009723	Biological Process	response to ethylene
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010200	Biological Process	response to chitin
GO:0046686	Biological Process	response to cadmium ion
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MSSNSMRKDV DRIKGPWSPE EDELLQQLVQ KHGPRNWSLI SKSIQGRSGK SCRLRWCNQL 60 SPQVEXQQQQ QRYLVQQHQQ HVQQQQQQMM MMHNGMGMGM GMGMMQASAA NDGFRNNAIK 120 RIGINKIE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	6e-18	13	80	3	73	C-Myb DNA-Binding Domain
1msf_C	6e-18	13	80	3	73	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00476	DAP	Transfer from AT4G37260	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009588514.1	2e-35	PREDICTED: transcription factor MYB44
Refseq	XP_016478014.1	2e-35	PREDICTED: transcription factor MYB44-like
Refseq	XP_028080167.1	1e-35	transcription factor MYB44-like
Swissprot	O23160	2e-34	MYB73_ARATH; Transcription factor MYB73
TrEMBL	A0A328DM19	5e-34	A0A328DM19_9ASTE; Uncharacterized protein
TrEMBL	A0A484LGT6	4e-34	A0A484LGT6_9ASTE; Uncharacterized protein
TrEMBL	A0A484MEM6	4e-34	A0A484MEM6_9ASTE; Uncharacterized protein
STRING	XP_009588514.1	8e-35	(Nicotiana tomentosiformis)

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]