PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

e_gw1.1.754.1

Common Name

COCSUDRAFT_11556

Organism

Coccomyxa subellipsoidea C-169

Taxonomic ID

574566

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea

Family

NF-YB

Protein Properties

Length: 117aa MW: 13246.1 Da PI: 4.6962

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
e_gw1.1.754.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	176.4	2.9e-55	15	107	1	93
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddl+wa++ lGfe+y eplk+yl+kyre+ e_gw1.1.754.1 15 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLVWAMGILGFEEYGEPLKLYLHKYREV 107 69*****************************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.3E-51	12	106	IPR009072	Histone-fold
SuperFamily	SSF47113	9.78E-38	18	107	IPR009072	Histone-fold
Pfam	PF00808	3.9E-28	21	85	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	3.0E-20	49	67	No hit	No description
PROSITE pattern	PS00685	0	52	68	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	3.0E-20	68	86	No hit	No description
PRINTS	PR00615	3.0E-20	87	105	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MDNDLDDGDE KGGNVREQDR FLPIANISRI MKKALPANAK IAKDAKETVQ ECVSEFISFI 60 TSEASDKCQR EKRKTINGDD LVWAMGILGF EEYGEPLKLY LHKYREVCFE ILLKDS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-46	15	106	1	92	Transcription factor HapC (Eurofung)
4g92_B	1e-46	15	106	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005651963.1	1e-81	CCAAT-binding transcription factor subunit A
Swissprot	O23310	6e-59	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	I0Z9V0	3e-80	I0Z9V0_COCSC; CCAAT-binding transcription factor subunit A
STRING	XP_005651963.1	6e-81	(Coccomyxa subellipsoidea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP2023	16	16

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-61	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Entrez Gene	17045434

Publications ? help Back to Top
Blanc G, et al. The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation. Genome Biol., 2012. 13(5): p. R39 [PMID:22630137] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]