PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

e_gw1.2.707.1

Common Name

CHLNCDRAFT_19177

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella

Family

Protein Properties

Length: 57aa MW: 6742.76 Da PI: 9.5749

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
e_gw1.2.707.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	68.5	1.4e-21	1	57	19	75
HHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS SBP 19 rrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 +r++vCe+ + a++vl +g+ qrfCqqC+rfh ls fD + r+Cr++La+h + +rk e_gw1.2.707.1 1 QRYRVCEKDALAEAVLQDGQLQRFCQQCGRFHPLSFFDATMRTCREQLARHASLKRK 57 69*************************************************998886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51141	19.016	1	57	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	8.8E-18	1	45	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.5E-20	1	57	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.09E-18	1	57	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 57 aa Download sequence Send to blast
QRYRVCEKDA LAEAVLQDGQ LQRFCQQCGR FHPLSFFDAT MRTCREQLAR HASLKRK

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005851469.1	8e-35	hypothetical protein CHLNCDRAFT_19177, partial
Swissprot	Q38740	2e-14	SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBL	E1Z4L6	2e-33	E1Z4L6_CHLVA; Uncharacterized protein (Fragment)
STRING	XP_005851469.1	3e-34	(Chlorella variabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP20	12	101

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G20980.1	3e-15	squamosa promoter binding protein-like 14

Link Out ? help Back to Top
Entrez Gene	17358528

Publications ? help Back to Top
Blanc G, et al. The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex. Plant Cell, 2010. 22(9): p. 2943-55 [PMID:20852019] Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]