PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

e_gw1.25.168.1

Common Name

CHLNCDRAFT_27387

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella

Family

Protein Properties

Length: 56aa MW: 6511.49 Da PI: 12.5823

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
e_gw1.25.168.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	60.3	5e-19	1	56	18	73
HHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS SBP 18 hrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 hr +++C +hs ap+v+++g+++rfCqq +rfh l f ++rsC L +h +rr e_gw1.25.168.1 1 HRSYRICVAHSTAPQVVLRGTSHRFCQQHGRFHLLAAFTGRQRSCAASLTRHRKRR 56 899***************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51141	17.486	1	56	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.2E-17	1	56	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	1.2E-17	1	45	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	5.98E-16	1	56	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 56 aa Download sequence Send to blast
HRSYRICVAH STAPQVVLRG TSHRFCQQHG RFHLLAAFTG RQRSCAASLT RHRKRR

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005844034.1	2e-32	hypothetical protein CHLNCDRAFT_27387, partial
TrEMBL	E1ZQH1	5e-31	E1ZQH1_CHLVA; Uncharacterized protein (Fragment)
STRING	XP_005844034.1	8e-32	(Chlorella variabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP20	12	101

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G27370.4	2e-14	squamosa promoter binding protein-like 10

Link Out ? help Back to Top
Entrez Gene	17351365

Publications ? help Back to Top
Blanc G, et al. The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex. Plant Cell, 2010. 22(9): p. 2943-55 [PMID:20852019]