PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

e_gw1.3.530.1

Common Name

COCSUDRAFT_12896

Organism

Coccomyxa subellipsoidea C-169

Taxonomic ID

574566

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea

Family

MYB

Protein Properties

Length: 107aa MW: 11931.7 Da PI: 10.3738

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
e_gw1.3.530.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.1	9.8e-19	7	52	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+WT+eEde l+++v ++G+++W++Ia + gR++k+c++rw + e_gw1.3.530.1 7 KGAWTPEEDEALKRLVLMHGPKNWSLIAGGIH-GRSGKSCRLRWCNQ 52 79****************************.*********985 PP
2	Myb_DNA-binding	50.5	4.6e-16	59	103	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++++++Ed +++a+ +G++ W+ Ia+ ++ gRt++ +k++w++ e_gw1.3.530.1 59 KDPFSEWEDAVIINAHIAHGNK-WAVIAKLLP-GRTDNGVKNHWNST 103 689*****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.714	1	57	IPR017930	Myb domain
SuperFamily	SSF46689	1.27E-30	5	100	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-15	6	55	IPR001005	SANT/Myb domain
Pfam	PF00249	5.1E-18	7	52	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-24	8	60	IPR009057	Homeodomain-like
CDD	cd00167	2.51E-13	9	51	No hit	No description
SMART	SM00717	2.2E-12	58	106	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	17.699	58	107	IPR017930	Myb domain
Pfam	PF00249	6.1E-14	59	103	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.1E-22	61	107	IPR009057	Homeodomain-like
CDD	cd00167	3.05E-9	61	104	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
MSGDAKKGAW TPEEDEALKR LVLMHGPKNW SLIAGGIHGR SGKSCRLRWC NQLDPGVIKD 60 PFSEWEDAVI INAHIAHGNK WAVIAKLLPG RTDNGVKNHW NSTLKRK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	7e-37	7	107	4	104	MYB PROTO-ONCOGENE PROTEIN
1mse_C	9e-37	7	107	4	104	C-Myb DNA-Binding Domain
1msf_C	9e-37	7	107	4	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Required for male gametophyte (pollen) development. {ECO:0000269\|PubMed:22101548}.
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00653	PBM	Transfer from LOC_Os02g09480	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.
UniProt	INDUCTION: May be the target of the microRNA (miRNA) MIR393a. {ECO:0000269\|PubMed:15258262}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	-	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005650301.1	1e-73	hypothetical protein COCSUDRAFT_12896, partial
Swissprot	O04192	8e-45	MYB25_ARATH; Transcription factor MYB25
Swissprot	Q9FDW1	5e-45	MYB44_ARATH; Transcription factor MYB44
TrEMBL	I0Z538	3e-72	I0Z538_COCSC; Uncharacterized protein (Fragment)
STRING	XP_005650301.1	5e-73	(Coccomyxa subellipsoidea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP15	16	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G55730.1	3e-48	myb domain protein 109

Link Out ? help Back to Top
Entrez Gene	17043761

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Blanc G, et al. The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation. Genome Biol., 2012. 13(5): p. R39 [PMID:22630137] Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]