![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.TU.contig_36543.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 123aa MW: 14272.5 Da PI: 10.5751 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 63.1 | 3e-20 | 11 | 52 | 3 | 44 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
i+n+s r++tf kR++g++KKA+EL +LC+++ ++ii+s+ +
evm.TU.contig_36543.1 11 ISNESTRKITFQKRKKGLMKKASELATLCGINMCMIIYSPYN 52
9**************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 16.946 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.6E-23 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-11 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.44E-24 | 4 | 95 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 7.07E-29 | 4 | 85 | No hit | No description |
| Pfam | PF00319 | 7.4E-20 | 11 | 52 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-11 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-11 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 123 aa Download sequence Send to blast |
MKGKKVKLAL ISNESTRKIT FQKRKKGLMK KASELATLCG INMCMIIYSP YNTQPEVWPS 60 PSGVQSVLND FNAMSKIDQS KKMLNQEVFV RQYMKKTNDQ LNKQRKDNRD KEITQLMFDS 120 LNX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.TU.contig_36543.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021898171.1 | 2e-66 | agamous-like MADS-box protein AGL80 | ||||
| Swissprot | Q9FJK3 | 4e-39 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
| TrEMBL | A0A0A0LVS3 | 1e-50 | A0A0A0LVS3_CUCSA; Uncharacterized protein | ||||
| STRING | evm.TU.contig_36543.1 | 3e-85 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM70 | 28 | 415 | Representative plant | OGRP114 | 13 | 173 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48670.1 | 2e-41 | AGAMOUS-like 80 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.TU.contig_36543.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




