![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.TU.contig_41047.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 104aa MW: 11661.7 Da PI: 10.862 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 55.7 | 6.5e-18 | 14 | 48 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+C + Tp+WR gp g+ktLCnaCG++y++ +l
evm.TU.contig_41047.1 14 CSHCLAQRTPQWRAGPMGPKTLCNACGVRYKSGRL 48
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.1E-16 | 8 | 62 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.332 | 8 | 44 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.81E-15 | 12 | 71 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 8.9E-15 | 12 | 46 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.70E-11 | 13 | 60 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 14 | 39 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 1.1E-15 | 14 | 48 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MVMESEKVQQ VRRCSHCLAQ RTPQWRAGPM GPKTLCNACG VRYKSGRLLP EYRPAKSPTF 60 VSYLHSNSHK KVLEMRMANT NLHPPPPPPP PPIHLSTLHI KKS* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.TU.contig_41047.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011010123.1 | 1e-44 | PREDICTED: GATA transcription factor 12-like | ||||
| Swissprot | Q9FH57 | 2e-34 | GATA5_ARATH; GATA transcription factor 5 | ||||
| TrEMBL | A0A2C9VIF2 | 1e-42 | A0A2C9VIF2_MANES; Uncharacterized protein | ||||
| TrEMBL | A0A2P2JWN9 | 7e-43 | A0A2P2JWN9_RHIMU; Uncharacterized protein MANES_09G142600 | ||||
| TrEMBL | A0A2P2JWQ4 | 6e-43 | A0A2P2JWQ4_RHIMU; Uncharacterized protein MANES_09G142600 | ||||
| STRING | evm.TU.contig_41047.1 | 3e-70 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM17095 | 9 | 11 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 7e-38 | GATA family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.TU.contig_41047.1 |




