![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_1.48 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 182aa MW: 21262.4 Da PI: 10.1429 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 172.6 | 1.2e-53 | 9 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyW 83
lppGfrFhPtdeel+++yL++++ ++++++ ++i+e++iyk++Pw+Lp k++ +e+ewyfFs+r++ky++g r+nrat sgyW
evm.model.supercontig_1.48 9 LPPGFRFHPTDEELIMYYLRNQLFSRPCPA-SIIPELNIYKFDPWQLPDKAEFGENEWYFFSPRERKYPNGVRPNRATVSGYW 90
79****************************.89***************99999****************************** PP
NAM 84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
katg+dk+++s +++ vg+kk Lvfykg+ pkg kt+W+mheyrl
evm.model.supercontig_1.48 91 KATGTDKAIYS-SSTYVGVKKALVFYKGKPPKGIKTNWIMHEYRL 134
***********.9999***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.22E-66 | 5 | 158 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 60.773 | 9 | 158 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.7E-27 | 10 | 134 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009825 | Biological Process | multidimensional cell growth | ||||
| GO:0009835 | Biological Process | fruit ripening | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0010150 | Biological Process | leaf senescence | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 182 aa Download sequence Send to blast |
MEGKSNSNLP PGFRFHPTDE ELIMYYLRNQ LFSRPCPASI IPELNIYKFD PWQLPDKAEF 60 GENEWYFFSP RERKYPNGVR PNRATVSGYW KATGTDKAIY SSSTYVGVKK ALVFYKGKPP 120 KGIKTNWIMH EYRLNQSRKQ SKGSMRLDDW VLCRIYKRKL SKVLESHKLV EEMPQPHSMS 180 S* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 7e-69 | 8 | 161 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 7e-69 | 8 | 161 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 7e-69 | 8 | 161 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 7e-69 | 8 | 161 | 16 | 168 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 3swm_B | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 3swm_C | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 3swm_D | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 3swp_A | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 3swp_B | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 3swp_C | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 3swp_D | 7e-69 | 8 | 161 | 19 | 171 | NAC domain-containing protein 19 |
| 4dul_A | 7e-69 | 8 | 161 | 16 | 168 | NAC domain-containing protein 19 |
| 4dul_B | 7e-69 | 8 | 161 | 16 | 168 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00221 | DAP | Transfer from AT1G69490 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_1.48 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021910534.1 | 1e-131 | LOW QUALITY PROTEIN: NAC transcription factor 29-like | ||||
| Swissprot | K4BNG7 | 1e-100 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
| TrEMBL | A0A1D6YZE6 | 1e-127 | A0A1D6YZE6_CARPA; NAC1 | ||||
| STRING | evm.model.supercontig_1.48 | 1e-133 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7707 | 26 | 41 | Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 1e-100 | NAC-like, activated by AP3/PI | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_1.48 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




