PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MYB_related
Protein Properties Length: 71aa    MW: 8570.74 Da    PI: 10.1801
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1055.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding568.9e-182468147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  evm.model.supercontig_1055.1 24 RERWTEEEHSRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                                  78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-171870IPR009057Homeodomain-like
PROSITE profilePS5129420.8081971IPR017930Myb domain
TIGRFAMsTIGR015572.1E-182271IPR006447Myb domain, plants
SMARTSM007171.2E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-102464IPR009057Homeodomain-like
PfamPF002499.0E-152467IPR001005SANT/Myb domain
CDDcd001672.38E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 71 aa     Download sequence    Send to blast
MDTYSSGEEL IIKTRKPYTI TKQRERWTEE EHSRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS K
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the circadian clock. Binds to the promoter region of APRR1/TOC1 and TCP21/CHE to repress their transcription. Represses both CCA1 and itself. {ECO:0000269|PubMed:12015970, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:9657154}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1055.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with peak levels occurring around 1 hour after dawn. Up-regulated by APRR1/TOC1 and transiently by light treatment. Down-regulated by APRR5, APRR7 and APRR9. {ECO:0000269|PubMed:12574129, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:19286557, ECO:0000269|PubMed:20233950, ECO:0000269|PubMed:9657154}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021896768.13e-45protein CCA1-like
SwissprotQ6R0H11e-36LHY_ARATH; Protein LHY
TrEMBLA0A1U8N9D93e-43A0A1U8N9D9_GOSHI; protein CCA1-like
TrEMBLA0A2N9I3T04e-43A0A2N9I3T0_FAGSY; Uncharacterized protein
STRINGevm.model.supercontig_1055.15e-45(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144321922
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.44e-39MYB_related family protein
Publications ? help Back to Top
  1. Pokhilko A,Mas P,Millar AJ
    Modelling the widespread effects of TOC1 signalling on the plant circadian clock and its outputs.
    BMC Syst Biol, 2013. 7: p. 23
    [PMID:23506153]
  2. Kim Y, et al.
    Balanced nucleocytosolic partitioning defines a spatial network to coordinate circadian physiology in plants.
    Dev. Cell, 2013. 26(1): p. 73-85
    [PMID:23830866]
  3. Karayekov E,Sellaro R,Legris M,Yanovsky MJ,Casal JJ
    Heat shock-induced fluctuations in clock and light signaling enhance phytochrome B-mediated Arabidopsis deetiolation.
    Plant Cell, 2013. 25(8): p. 2892-906
    [PMID:23933882]
  4. Higham CF,Husmeier D
    A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana.
    BMC Bioinformatics, 2013. 14 Suppl 10: p. S3
    [PMID:24267177]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Qian H, et al.
    The circadian clock gene regulatory module enantioselectively mediates imazethapyr-induced early flowering in Arabidopsis thaliana.
    J. Plant Physiol., 2014. 171(5): p. 92-8
    [PMID:24484962]
  7. McClung CR
    Wheels within wheels: new transcriptional feedback loops in the Arabidopsis circadian clock.
    F1000Prime Rep, 2014. 6: p. 2
    [PMID:24592314]
  8. Gulledge AA,Vora H,Patel K,Loraine AE
    A protocol for visual analysis of alternative splicing in RNA-Seq data using integrated genome browser.
    Methods Mol. Biol., 2014. 1158: p. 123-37
    [PMID:24792048]
  9. Hsiao AS, et al.
    Gene expression in plant lipid metabolism in Arabidopsis seedlings.
    PLoS ONE, 2014. 9(9): p. e107372
    [PMID:25264899]
  10. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  11. Litthauer S,Battle MW,Lawson T,Jones MA
    Phototropins maintain robust circadian oscillation of PSII operating efficiency under blue light.
    Plant J., 2015. 83(6): p. 1034-45
    [PMID:26215041]
  12. Flis A, et al.
    Defining the robust behaviour of the plant clock gene circuit with absolute RNA timeseries and open infrastructure.
    Open Biol, 2016.
    [PMID:26468131]
  13. Adams S,Manfield I,Stockley P,Carré IA
    Revised Morning Loops of the Arabidopsis Circadian Clock Based on Analyses of Direct Regulatory Interactions.
    PLoS ONE, 2015. 10(12): p. e0143943
    [PMID:26625126]
  14. Kamioka M, et al.
    Direct Repression of Evening Genes by CIRCADIAN CLOCK-ASSOCIATED1 in the Arabidopsis Circadian Clock.
    Plant Cell, 2016. 28(3): p. 696-711
    [PMID:26941090]
  15. Baduel P,Arnold B,Weisman CM,Hunter B,Bomblies K
    Habitat-Associated Life History and Stress-Tolerance Variation in Arabidopsis arenosa.
    Plant Physiol., 2016. 171(1): p. 437-51
    [PMID:26941193]
  16. Park MJ,Kwon YJ,Gil KE,Park CM
    LATE ELONGATED HYPOCOTYL regulates photoperiodic flowering via the circadian clock in Arabidopsis.
    BMC Plant Biol., 2016. 16(1): p. 114
    [PMID:27207270]
  17. Nitschke S, et al.
    Circadian Stress Regimes Affect the Circadian Clock and Cause Jasmonic Acid-Dependent Cell Death in Cytokinin-Deficient Arabidopsis Plants.
    Plant Cell, 2016. 28(7): p. 1616-39
    [PMID:27354555]
  18. Higashi T,Aoki K,Nagano AJ,Honjo MN,Fukuda H
    Circadian Oscillation of the Lettuce Transcriptome under Constant Light and Light-Dark Conditions.
    Front Plant Sci, 2016. 7: p. 1114
    [PMID:27512400]
  19. Marshall CM,Tartaglio V,Duarte M,Harmon FG
    The Arabidopsis sickle Mutant Exhibits Altered Circadian Clock Responses to Cool Temperatures and Temperature-Dependent Alternative Splicing.
    Plant Cell, 2016. 28(10): p. 2560-2575
    [PMID:27624757]
  20. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  21. Wendell M, et al.
    Thermoperiodic Control of Floral Induction Involves Modulation of the Diurnal FLOWERING LOCUS T Expression Pattern.
    Plant Cell Physiol., 2017. 58(3): p. 466-477
    [PMID:28028164]
  22. Woloszynska M, et al.
    The Elongator complex regulates hypocotyl growth in darkness and during photomorphogenesis.
    J. Cell. Sci., 2019.
    [PMID:28720596]
  23. Li Z,Bonaldi K,Uribe F,Pruneda-Paz JL
    A Localized Pseudomonas syringae Infection Triggers Systemic Clock Responses in Arabidopsis.
    Curr. Biol., 2018. 28(4): p. 630-639.e4
    [PMID:29398214]
  24. James AB,Sullivan S,Nimmo HG
    Global spatial analysis of Arabidopsis natural variants implicates 5'UTR splicing of LATE ELONGATED HYPOCOTYL in responses to temperature.
    Plant Cell Environ., 2018. 41(7): p. 1524-1538
    [PMID:29520807]
  25. James AB, et al.
    How does temperature affect splicing events? Isoform switching of splicing factors regulates splicing of LATE ELONGATED HYPOCOTYL (LHY).
    Plant Cell Environ., 2018. 41(7): p. 1539-1550
    [PMID:29532482]