![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | evm.model.supercontig_183.32 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 93aa MW: 10497.8 Da PI: 9.3639 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 30.5 | 6.7e-10 | 19 | 59 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+i + + +L++l+P++ + +s Kls + +L+++++YI++L
evm.model.supercontig_183.32 19 DQITELITKLQQLIPELRHRRSDKLSASKVLQETCNYIRNL 59
6899************879********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.280.10 | 1.2E-9 | 3 | 73 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| PROSITE profile | PS50888 | 11.033 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 5.89E-10 | 18 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 2.8E-7 | 19 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MSSRRSRSRQ SSSSRISDDQ ITELITKLQQ LIPELRHRRS DKLSASKVLQ ETCNYIRNLH 60 REVDDLSDRL SALLASTDSD SPEAAIIRSL LM* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | evm.model.supercontig_183.32 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021887859.1 | 6e-57 | transcription factor PRE6-like | ||||
| Swissprot | Q9LJX1 | 1e-38 | PRE5_ARATH; Transcription factor PRE5 | ||||
| TrEMBL | A0A1U8FK00 | 2e-43 | A0A1U8FK00_CAPAN; Transcription factor PRE5 | ||||
| TrEMBL | A0A2G2XD16 | 2e-43 | A0A2G2XD16_CAPBA; Transcription factor PRE5 | ||||
| TrEMBL | A0A2G3A645 | 2e-43 | A0A2G3A645_CAPAN; transcription factor PRE6-like | ||||
| STRING | evm.model.supercontig_183.32 | 2e-56 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM259 | 28 | 225 | Representative plant | OGRP1877 | 12 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 7e-25 | bHLH family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | evm.model.supercontig_183.32 |




