PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.model.supercontig_196.1

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

NF-YB

Protein Properties

Length: 176aa MW: 19030.2 Da PI: 8.0669

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_196.1	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	181.3	8.5e-57	22	117	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvepl 83 ++qdrflPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGf++yv+pl evm.model.supercontig_196.1 22 KDQDRFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFDNYVAPL 103 79****************************************************************************** PP NF-YB 84 kvylkkyrelegek 97 k+yl+kyr++eg+k evm.model.supercontig_196.1 104 KIYLNKYRDTEGDK 117 **********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.8E-53	19	128	IPR009072	Histone-fold
SuperFamily	SSF47113	7.3E-41	24	131	IPR009072	Histone-fold
Pfam	PF00808	1.2E-27	27	91	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	6.7E-20	55	73	No hit	No description
PROSITE pattern	PS00685	0	58	74	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	6.7E-20	74	92	No hit	No description
PRINTS	PR00615	6.7E-20	93	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 176 aa Download sequence Send to blast
MAGKRKETCS PMSSPVSDNS SKDQDRFLPI ANVSRIMKKS LPANAKISKE AKETVQECVS 60 EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFDNYV APLKIYLNKY RDTEGDKNGN 120 SPSSNHAGVY SDHAGTVIGY GGFTGSRIIR QDGDDGNGST VSMAAHLHQN GGFGW*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	5e-48	22	112	2	92	Transcription factor HapC (Eurofung)
4g92_B	5e-48	22	112	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_196.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021887454.1	1e-130	nuclear transcription factor Y subunit B-1-like
Swissprot	O23310	4e-60	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A220D3E0	4e-72	A0A220D3E0_MALDO; Nuclear transcription factor Y subunit B-3-like
STRING	evm.model.supercontig_196.1	1e-129	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	1e-61	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_196.1

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]